KEGG   Cellulomonas gilvus: Celgi_1643Help
Entry
Celgi_1643        CDS       T01537                                 

Definition
(RefSeq) triosephosphate isomerase
  KO
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
cga  Cellulomonas gilvus
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:cga00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Celgi_1643
   01230 Biosynthesis of amino acids
    Celgi_1643
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Celgi_1643
   00051 Fructose and mannose metabolism
    Celgi_1643
   00562 Inositol phosphate metabolism
    Celgi_1643
Enzymes [BR:cga01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Celgi_1643
Exosome [BR:cga04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Celgi_1643
  Exosomal proteins of bladder cancer cells
   Celgi_1643
  Exosomal proteins of melanoma cells
   Celgi_1643
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1791608..1792402
Genome map
AA seq 264 aa AA seqDB search
MAQRTPLMAGNWKMNLDHQQAIQTLQKLAWTLKDAKHDYGTVEVAVIPPFTDLRSVQTLV
DADQLEIVYGAQDVSAHESGAYTGEIAPAFLTKLGVTYAVIGHSERREYHAESDELVNAK
VKNALGAGLKPILCVGEKLEVRKAGEHVPVTLGQLDGGLAGLTAEQVRDVVVAYEPVWAI
GTGETATPEDAQELCEAIRVRIAELYDQDTADAVRVLYGGSVKSSNVASIMTKPDVDGAL
IGGASLDPEEFAKIVRYQSHAVGL
NT seq 795 nt NT seq  +upstreamnt  +downstreamnt
atggctcagcgcaccccgctcatggcgggcaactggaagatgaacctggaccaccagcag
gcgatccagacgctccagaagctcgcgtggacgctcaaggacgccaagcacgactacggc
acggtcgaggtcgcggtcatcccgccgttcaccgacctgcgcagcgtgcagacgctcgtg
gacgccgaccagctggagatcgtgtacggcgcgcaggacgtgtcggcccacgagtccggc
gcgtacacgggggagatcgctccggcgttcctcaccaagctcggtgtcacgtacgccgtg
atcggccactcggagcggcgcgagtaccacgccgagtccgacgagctggtcaacgccaag
gtgaagaacgcgctcggcgcgggcctcaagccgatcctgtgcgtcggcgagaagctcgag
gtccgcaaggccggcgagcacgtgccggtcacgctgggtcagctggacggcggcctggcc
ggcctcacggccgagcaggtccgcgacgtcgtcgtggcgtacgagcccgtgtgggccatc
ggcaccggcgagaccgcgacgcccgaggacgcccaggagctgtgcgaggccatccgcgtg
cggatcgccgagctctacgaccaggacaccgcagacgcggtgcgcgtcctgtacggcggt
tcggtgaagtcgtcgaacgtcgcgtcgatcatgacgaagcccgacgtcgacggtgcgctc
atcggtggggccagcctggaccccgaggagttcgccaagatcgtgcgctaccagtcgcac
gccgtcggtctctga

DBGET integrated database retrieval system