KEGG   Cellulomonas gilvus: Celgi_1643Help
Entry
Celgi_1643        CDS       T01537                                 

Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
cga  Cellulomonas gilvus
Pathway
cga00010  Glycolysis / Gluconeogenesis
cga00051  Fructose and mannose metabolism
cga00562  Inositol phosphate metabolism
cga01100  Metabolic pathways
cga01110  Biosynthesis of secondary metabolites
cga01120  Microbial metabolism in diverse environments
cga01130  Biosynthesis of antibiotics
cga01200  Carbon metabolism
cga01230  Biosynthesis of amino acids
Module
cga_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:cga00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Celgi_1643
   00051 Fructose and mannose metabolism
    Celgi_1643
   00562 Inositol phosphate metabolism
    Celgi_1643
Enzymes [BR:cga01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Celgi_1643
Exosome [BR:cga04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Celgi_1643
  Exosomal proteins of bladder cancer cells
   Celgi_1643
  Exosomal proteins of melanoma cells
   Celgi_1643
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: AEI12154
UniProt: F8A5J9
Position
1791608..1792402
Genome map
AA seq 264 aa AA seqDB search
MAQRTPLMAGNWKMNLDHQQAIQTLQKLAWTLKDAKHDYGTVEVAVIPPFTDLRSVQTLV
DADQLEIVYGAQDVSAHESGAYTGEIAPAFLTKLGVTYAVIGHSERREYHAESDELVNAK
VKNALGAGLKPILCVGEKLEVRKAGEHVPVTLGQLDGGLAGLTAEQVRDVVVAYEPVWAI
GTGETATPEDAQELCEAIRVRIAELYDQDTADAVRVLYGGSVKSSNVASIMTKPDVDGAL
IGGASLDPEEFAKIVRYQSHAVGL
NT seq 795 nt NT seq  +upstreamnt  +downstreamnt
atggctcagcgcaccccgctcatggcgggcaactggaagatgaacctggaccaccagcag
gcgatccagacgctccagaagctcgcgtggacgctcaaggacgccaagcacgactacggc
acggtcgaggtcgcggtcatcccgccgttcaccgacctgcgcagcgtgcagacgctcgtg
gacgccgaccagctggagatcgtgtacggcgcgcaggacgtgtcggcccacgagtccggc
gcgtacacgggggagatcgctccggcgttcctcaccaagctcggtgtcacgtacgccgtg
atcggccactcggagcggcgcgagtaccacgccgagtccgacgagctggtcaacgccaag
gtgaagaacgcgctcggcgcgggcctcaagccgatcctgtgcgtcggcgagaagctcgag
gtccgcaaggccggcgagcacgtgccggtcacgctgggtcagctggacggcggcctggcc
ggcctcacggccgagcaggtccgcgacgtcgtcgtggcgtacgagcccgtgtgggccatc
ggcaccggcgagaccgcgacgcccgaggacgcccaggagctgtgcgaggccatccgcgtg
cggatcgccgagctctacgaccaggacaccgcagacgcggtgcgcgtcctgtacggcggt
tcggtgaagtcgtcgaacgtcgcgtcgatcatgacgaagcccgacgtcgacggtgcgctc
atcggtggggccagcctggaccccgaggagttcgccaagatcgtgcgctaccagtcgcac
gccgtcggtctctga

DBGET integrated database retrieval system