KEGG   Cellvibrio gilvus: Celgi_1819Help
Entry
Celgi_1819        CDS       T01537                                 

Definition
tryptophan synthase, alpha subunit
Orthology
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
cga  Cellvibrio gilvus
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:cga01230]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:cga00260]
Metabolism; Amino acid metabolism; Phenylalanine, tyrosine and tryptophan biosynthesis [PATH:cga00400]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1973468..1974319)
Genome map
AA seq 283 aa AA seqDB search
MSGTDVATDGLATGTTGPLLDGLAAQGRAALIGYLPVGYPTVPGSVQAVRTMIDAGADVV
ELGMPYTDPVMDGPVIQRAVDVALQQGTRVRDTLHAVEQVAGRGAPVVVMTYWNLVLRYG
VEAYARDLAAAGGAGMITPDLIPDEAAEWIAASDAHGLDRVFLVAPSSTPERLASTVAAS
RGFVYAASTMGVTGERTTVGARAEQLVADARAAGAPRVCVGVGVSRPEQAAQVASYADGV
IVGSALVRALVEAPDENAGLDRLADVTAALAQGVRSASRGGAA
NT seq 852 nt NT seq  +upstreamnt  +downstreamnt
gtgagcgggacggacgtggccacggacggcctcgcgaccgggaccacgggtccgctgctc
gacgggctcgctgcccagggccgtgcggcgctgatcggctacctgcccgtcggctacccc
acggtgcccggctcggtgcaggccgtgcgcaccatgatcgacgcgggtgcggacgtggtc
gagctcggcatgccgtacaccgaccccgtgatggacgggccggtcatccagcgggccgtc
gacgtcgcgctgcagcagggcacgcgcgtgcgcgacacgctgcatgcggtcgagcaggtg
gcgggccgcggtgcgcccgtggtggtcatgacctactggaacctggtgctgcgctacggg
gtcgaggcgtacgcgcgtgacctcgcggccgcgggcggtgcgggcatgatcacgccggac
ctcatccccgacgaggccgcggagtggatcgcggcgtccgacgcgcacgggctggaccgg
gtgttcctggtggccccgagctcgacgcccgagcgcctcgcgagcaccgtggcggcctcg
cgcggcttcgtgtacgcggcctccacgatgggcgtgacgggcgagcggaccacggtgggt
gcgcgtgccgagcagctcgtcgccgatgcgcgcgcggccggggcgccccgcgtctgcgtc
ggcgtgggcgtctcgcggcccgagcaggcggcgcaggtcgcgtcctacgcggacggggtc
atcgtcgggtcggcgctcgtgcgcgcgctcgtcgaggcccccgacgagaacgccgggctg
gaccggctcgcggacgtgaccgccgcgctcgcgcagggcgtgcggtccgcgtcgcgcggc
ggtgccgcatga

DBGET integrated database retrieval system