KEGG   Cellulomonas gilvus: Celgi_1819Help
Entry
Celgi_1819        CDS       T01537                                 

Definition
(GenBank) tryptophan synthase, alpha subunit (EC:4.2.1.20)
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
cga  Cellulomonas gilvus
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:cga00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Celgi_1819
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Celgi_1819
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Celgi_1819
Enzymes [BR:cga01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Celgi_1819
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(1973468..1974319)
Genome map
AA seq 283 aa AA seqDB search
MSGTDVATDGLATGTTGPLLDGLAAQGRAALIGYLPVGYPTVPGSVQAVRTMIDAGADVV
ELGMPYTDPVMDGPVIQRAVDVALQQGTRVRDTLHAVEQVAGRGAPVVVMTYWNLVLRYG
VEAYARDLAAAGGAGMITPDLIPDEAAEWIAASDAHGLDRVFLVAPSSTPERLASTVAAS
RGFVYAASTMGVTGERTTVGARAEQLVADARAAGAPRVCVGVGVSRPEQAAQVASYADGV
IVGSALVRALVEAPDENAGLDRLADVTAALAQGVRSASRGGAA
NT seq 852 nt NT seq  +upstreamnt  +downstreamnt
gtgagcgggacggacgtggccacggacggcctcgcgaccgggaccacgggtccgctgctc
gacgggctcgctgcccagggccgtgcggcgctgatcggctacctgcccgtcggctacccc
acggtgcccggctcggtgcaggccgtgcgcaccatgatcgacgcgggtgcggacgtggtc
gagctcggcatgccgtacaccgaccccgtgatggacgggccggtcatccagcgggccgtc
gacgtcgcgctgcagcagggcacgcgcgtgcgcgacacgctgcatgcggtcgagcaggtg
gcgggccgcggtgcgcccgtggtggtcatgacctactggaacctggtgctgcgctacggg
gtcgaggcgtacgcgcgtgacctcgcggccgcgggcggtgcgggcatgatcacgccggac
ctcatccccgacgaggccgcggagtggatcgcggcgtccgacgcgcacgggctggaccgg
gtgttcctggtggccccgagctcgacgcccgagcgcctcgcgagcaccgtggcggcctcg
cgcggcttcgtgtacgcggcctccacgatgggcgtgacgggcgagcggaccacggtgggt
gcgcgtgccgagcagctcgtcgccgatgcgcgcgcggccggggcgccccgcgtctgcgtc
ggcgtgggcgtctcgcggcccgagcaggcggcgcaggtcgcgtcctacgcggacggggtc
atcgtcgggtcggcgctcgtgcgcgcgctcgtcgaggcccccgacgagaacgccgggctg
gaccggctcgcggacgtgaccgccgcgctcgcgcagggcgtgcggtccgcgtcgcgcggc
ggtgccgcatga

DBGET integrated database retrieval system