KEGG   Cellulomonas gilvus: Celgi_1820Help
Entry
Celgi_1820        CDS       T01537                                 

Definition
(GenBank) tryptophan synthase, beta subunit
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
cga  Cellulomonas gilvus
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:cga00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Celgi_1820
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Celgi_1820
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Celgi_1820
Enzymes [BR:cga01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Celgi_1820
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(1974316..1975593)
Genome map
AA seq 425 aa AA seqDB search
MSGSGRPEVPGQEVRAGLLATHVGPYWGEFGGRFVPEALIAALDEIDTAYHKALTDPAFG
AELARLHRTYTGRPSPLTEVPRFAAHVGAGVRVFLKREDLNHTGSHKINNVLGQALLVKR
LGKTRVIAETGAGQHGVATATAAALLGLECTVYMGEEDTQRQALNVARMRLLGAEVIPVT
IGTRTLKDAINEALRDWVANVETTHYLLGTVTGPHPFPEMVRDFHKVIGEEARAQLLGEI
GRLPDAVAACVGGGSNAMGIFNAFLDDADVRLFGFEAGGRGLSAGDHAARFSGGFPGVLH
GARSYLLQDEDGQTVPSHSVSAGLDYPSVGPEHAWLHDIGRATYQPVSDDEAMTAFRLLC
RTEGIIPAIESAHALAGAIQIGPQATQWSDEPVILVNLSGRGDKDVATAARWFGLLDDEH
AEGDQ
NT seq 1278 nt NT seq  +upstreamnt  +downstreamnt
gtgagcgggtcaggccggccggaggtgcccgggcaggaggtgcgcgcgggcctgctcgcc
acgcacgtcgggccgtactggggcgagttcggcggacgcttcgtcccggaggcgctcatc
gcggcgctggacgagatcgacaccgcgtaccacaaggcgttgacggacccggcgttcggt
gccgagctcgcgcgcctgcaccgcacgtacaccggtcggccgagcccgctgacggaggtg
ccgcgcttcgcggcgcacgtcggtgcgggcgtgcgcgtgttcctcaagcgcgaggacctg
aaccacaccggctcgcacaagatcaacaacgtgctgggccaggcgctgctggtcaagcga
ctgggcaagacgcgcgtgatcgcggagacgggagcgggtcagcacggcgtcgcgaccgcg
accgcggccgcgctgctcggcctcgagtgcaccgtgtacatgggcgaggaggacacgcag
cgccaggcgctcaacgtcgcgcgcatgcggctgctcggcgccgaggtgatcccggtgacc
atcgggacgcgcacgctcaaggacgcgatcaacgaggcgctgcgcgactgggtcgccaac
gtcgagacgacgcactacctgctgggaaccgtcacgggtccgcacccgttcccggagatg
gtgcgcgacttccacaaggtcatcggtgaggaggcacgcgcgcagctgctcggcgagatc
gggcggctgccggacgcggtcgccgcgtgcgtcggaggcggctcgaacgcgatgggcatc
ttcaacgcgttcctggacgacgcggacgtccggctgttcggcttcgaggccggcgggcgc
gggctgtccgcgggggaccacgccgcgcgcttctcgggcgggttccccggggtcctgcac
ggcgcccgctcctacctgctgcaggacgaggacgggcagacggtcccgagccactcggtc
tcggcgggcctggactacccgagcgtcggccccgagcacgcgtggctgcacgacatcggc
cgcgccacgtaccagccggtctcggacgacgaggcgatgacggccttccgcctgctgtgc
cggacggagggcatcatcccggcgatcgagtcggcgcacgccctcgcgggtgcgatccag
atcggcccgcaggccacgcagtggtcggacgagccggtcatcctggtcaacctgtccggt
cgcggcgacaaggacgtcgcgacggccgcgcgctggttcgggctgctggacgacgagcat
gcggagggtgaccagtga

DBGET integrated database retrieval system