KEGG   Cellulomonas gilvus: Celgi_1958Help
Entry
Celgi_1958        CDS       T01537                                 

Definition
pyridoxal-phosphate dependent TrpB-like enzyme
Orthology
K06001  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
cga  Cellulomonas gilvus
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:cga00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Celgi_1958
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Celgi_1958
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Celgi_1958
Enzymes [BR:cga01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Celgi_1958
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2126931..2128247
Genome map
AA seq 438 aa AA seqDB search
MTSPDVQPAPARGVRTDPVGTFVPSAVPTHWYNLAADLPEPAPPALHPGTREPIGPQDLA
PLFPMALIAQEVSTERYVEIPQTVREMYALWRPSPLVRALRLERALGTPAKIFYKYEGVS
PAGSHKPNTAVAQAYYNAIEGITKLTTETGAGQWGASLSMACALVGIQCEVWQVRASFDA
KPYRRMQMETYGGVCHPSPSDLTEAGRAMLAADPDTTGSLGMAISEAVEVAAQDPHAHYA
LGSVLNHVLLHQSVIGVEALAQLDEIGEQADVVFGCAGGGSNLAGLSFPFIGRNLRDGTT
TQVVACEPAACPSLTQGEYRYDHGDVAGLTPLLKMHTLGKDFVPPPIHAGGLRYHGMAPM
VSHALELGLLSAIAVEQQEAFAAGIEFARAEGIIPAPESTHAVAGALARARAATTDETIV
IGLSGNGVLDLPAYHDYL
NT seq 1317 nt NT seq  +upstreamnt  +downstreamnt
atgacatcccccgacgtccagccagcgcccgcgaggggcgtgcgcaccgaccccgtcggc
acgttcgtgccctcggccgtcccgacgcactggtacaacctggcggccgacctgcccgag
ccggcaccgcccgcgctgcaccccggcacgcgggagccgatcgggccgcaggacctcgca
ccgctgttcccgatggcgctcatcgcgcaggaggtcagcaccgagcggtacgtcgagatc
ccgcagaccgtgcgggagatgtacgcgctgtggcggccctcaccgctggtccgggcgctg
cgtctcgagcgcgcgctcggcacgcccgccaagatcttctacaagtacgagggcgtctcc
cccgccggctcgcacaagcccaacaccgcggtggcgcaggcgtactacaacgcgatcgag
ggcatcaccaagctcaccacggagaccggcgcaggccagtggggcgcgtcgctgtccatg
gcgtgcgcgctcgtcgggatccagtgcgaggtgtggcaggtgcgcgcgtcgttcgacgcc
aagccgtaccgccgcatgcagatggagacgtacggcggcgtgtgccacccgtcgccgtcg
gacctcacggaggcgggccgcgccatgctggccgccgacccggacaccaccggctcgctc
ggcatggcgatctcggaggccgtcgaggtcgcggcgcaggacccgcacgcgcactacgcg
ctgggctcggtgctcaaccacgtgctgctccaccagagcgtcatcggggtggaggcgctg
gcccagctcgacgagatcggcgagcaggccgacgtcgtgttcggctgcgcgggcggcggc
tccaacctcgccgggctgagcttcccgttcatcgggcgcaacctgcgtgacgggacgacg
acgcaggtcgtcgcgtgcgagcccgcggcgtgcccctcgctcacgcagggcgagtaccgg
tacgaccacggcgacgtcgccggcctgaccccgctgctcaagatgcacacgctcggcaag
gacttcgtcccgccgcccatccacgccggtgggctgcgctaccacgggatggcgccgatg
gtctcgcacgcgctcgagctggggctgctctcggcgatcgcggtggagcagcaggaggcc
ttcgcggccggcatcgagttcgcgcgcgccgaggggatcatccccgcgcccgagtcgacg
cacgccgtggccggcgcgctcgcccgggcccgcgccgcgaccacggacgagacgatcgtc
atcggcctgtccggcaacggcgtgctggacctgcccgcctaccacgactacctctag

DBGET integrated database retrieval system