KEGG   Cellulomonas gilvus: Celgi_1958Help
Entry
Celgi_1958        CDS       T01537                                 

Definition
(GenBank) pyridoxal-phosphate dependent TrpB-like enzyme (EC:4.2.1.20)
  KO
K06001  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
cga  Cellulomonas gilvus
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:cga00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Celgi_1958
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Celgi_1958
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Celgi_1958
Enzymes [BR:cga01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Celgi_1958
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
2126931..2128247
Genome map
AA seq 438 aa AA seqDB search
MTSPDVQPAPARGVRTDPVGTFVPSAVPTHWYNLAADLPEPAPPALHPGTREPIGPQDLA
PLFPMALIAQEVSTERYVEIPQTVREMYALWRPSPLVRALRLERALGTPAKIFYKYEGVS
PAGSHKPNTAVAQAYYNAIEGITKLTTETGAGQWGASLSMACALVGIQCEVWQVRASFDA
KPYRRMQMETYGGVCHPSPSDLTEAGRAMLAADPDTTGSLGMAISEAVEVAAQDPHAHYA
LGSVLNHVLLHQSVIGVEALAQLDEIGEQADVVFGCAGGGSNLAGLSFPFIGRNLRDGTT
TQVVACEPAACPSLTQGEYRYDHGDVAGLTPLLKMHTLGKDFVPPPIHAGGLRYHGMAPM
VSHALELGLLSAIAVEQQEAFAAGIEFARAEGIIPAPESTHAVAGALARARAATTDETIV
IGLSGNGVLDLPAYHDYL
NT seq 1317 nt NT seq  +upstreamnt  +downstreamnt
atgacatcccccgacgtccagccagcgcccgcgaggggcgtgcgcaccgaccccgtcggc
acgttcgtgccctcggccgtcccgacgcactggtacaacctggcggccgacctgcccgag
ccggcaccgcccgcgctgcaccccggcacgcgggagccgatcgggccgcaggacctcgca
ccgctgttcccgatggcgctcatcgcgcaggaggtcagcaccgagcggtacgtcgagatc
ccgcagaccgtgcgggagatgtacgcgctgtggcggccctcaccgctggtccgggcgctg
cgtctcgagcgcgcgctcggcacgcccgccaagatcttctacaagtacgagggcgtctcc
cccgccggctcgcacaagcccaacaccgcggtggcgcaggcgtactacaacgcgatcgag
ggcatcaccaagctcaccacggagaccggcgcaggccagtggggcgcgtcgctgtccatg
gcgtgcgcgctcgtcgggatccagtgcgaggtgtggcaggtgcgcgcgtcgttcgacgcc
aagccgtaccgccgcatgcagatggagacgtacggcggcgtgtgccacccgtcgccgtcg
gacctcacggaggcgggccgcgccatgctggccgccgacccggacaccaccggctcgctc
ggcatggcgatctcggaggccgtcgaggtcgcggcgcaggacccgcacgcgcactacgcg
ctgggctcggtgctcaaccacgtgctgctccaccagagcgtcatcggggtggaggcgctg
gcccagctcgacgagatcggcgagcaggccgacgtcgtgttcggctgcgcgggcggcggc
tccaacctcgccgggctgagcttcccgttcatcgggcgcaacctgcgtgacgggacgacg
acgcaggtcgtcgcgtgcgagcccgcggcgtgcccctcgctcacgcagggcgagtaccgg
tacgaccacggcgacgtcgccggcctgaccccgctgctcaagatgcacacgctcggcaag
gacttcgtcccgccgcccatccacgccggtgggctgcgctaccacgggatggcgccgatg
gtctcgcacgcgctcgagctggggctgctctcggcgatcgcggtggagcagcaggaggcc
ttcgcggccggcatcgagttcgcgcgcgccgaggggatcatccccgcgcccgagtcgacg
cacgccgtggccggcgcgctcgcccgggcccgcgccgcgaccacggacgagacgatcgtc
atcggcctgtccggcaacggcgtgctggacctgcccgcctaccacgactacctctag

DBGET integrated database retrieval system