KEGG   Cellulomonas gilvus: Celgi_1999Help
Entry
Celgi_1999        CDS       T01537                                 

Definition
UDP-N-acetylmuramyl-tripeptide synthetase
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
cga  Cellulomonas gilvus
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:cga00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    Celgi_1999
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Celgi_1999
Enzymes [BR:cga01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.13  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate---2,6-diaminopimelate ligase
     Celgi_1999
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2175755..2177320)
Genome map
AA seq 521 aa AA seqDB search
MRPRHAVDRSLATIAATFSLVTSDVEGASPVSADATVRGVSMASDDVQPGDLFVAVPGAR
VHGARFAADAVGAGAAAVVTDAAGVAVLGDLVRRVPVLVADDPRALAGPLAAHVLGRPAE
RLTTVGVTGTNGKTTTTYFVDAALRAAHASTAVLGTVELRIGEDAIESPRTTVEAPVLHG
VLALALERGATAVAMEVSSHALALHRVAGTTFDVVGFTNLQRDHLDFHGDMEGYFRDKAR
LFAPGQARRGVVVVDDEWGARLAREAQIPVESVATHVGDPAAADADWAVVSADVGLDGVG
STFVLRGPDGARHDAVSPLPGLVNVSNAALAIVLAHAAGVDLQVAIGAVATAHAIPGRME
RVIERAPGRALALVDYAHTPDALVLALEAVRPITPGRLVIVFGSDGDRDRGKRPIMGEIA
ARLADVLVVTDENPRSEDPASIRAAILDGVRTVRPDLTDVLEVEPRAEAVRRGVALAREG
DTVIVTGKGHEPTQEIAGVFHRYNDRDVLLAVRDESAGGHA
NT seq 1566 nt NT seq  +upstreamnt  +downstreamnt
atgcggcctcggcatgccgtcgaccggtcgctcgcgacgatcgcggcgacgttctcgctg
gtcacctcggacgtcgagggggcgtcgccggtctcggccgacgccaccgtgcgcggcgtg
agcatggcgagcgacgacgtgcagccgggcgacctgttcgtggccgtgccgggggcacgc
gtgcacggtgcgcgcttcgcggccgacgcggtcggcgcgggtgcggccgcggtcgtgacc
gacgccgcgggcgtcgcggtcctcggtgacctggtgcgtcgcgtgccggtgctcgtggcc
gacgacccccgcgcgctcgcgggcccgctcgcggcccacgtgctgggccgcccggccgag
cgcctgaccacggtcggcgtgaccgggacgaacggcaagacgacgacgacgtacttcgtg
gacgccgcgctgcgcgccgcgcacgcgagcaccgcggtgctcggcacggtcgagctgcgg
atcggcgaggacgcgatcgagagcccgcgcaccacggtcgaggccccggtgctgcacggc
gtgctcgcgctcgcgctcgagcgcggtgcgaccgcggtcgcgatggaggtctcgtcgcac
gcgctcgcgctgcaccgcgtcgcgggcaccacgttcgacgtggtgggcttcaccaacctg
cagcgcgaccacctggacttccacggcgacatggagggctacttccgggacaaggcgcgc
ctgttcgcgccgggtcaggcccggcgtggcgtcgtcgtcgtggacgacgagtggggcgcc
cggctcgcgcgcgaggcacagatcccggtcgagtcggtcgcgacgcacgtcggcgacccc
gcggcggcggatgcggactgggccgtcgtctcggcggacgtcgggctcgacggcgtcggt
tcgacgttcgtgctgcgcggccccgacggggcccggcacgacgccgtgagcccgctgccg
ggcctggtcaacgtctccaacgcggcgctcgcgatcgtgctggcgcacgccgcgggtgtg
gacctgcaggtggcgatcggcgcggtcgcgaccgcgcacgcgatcccgggccgcatggag
cgcgtcatcgagcgcgcgcccgggcgtgcgctcgcgctcgtcgactacgcgcacacgccc
gacgcgctcgtgctcgcgctcgaggcggtgcggcccatcacgcccggccggctcgtcatc
gtgttcggctcggacggtgaccgcgaccgcggcaagcggccgatcatgggcgagatcgcg
gcgcggctcgccgacgtcctcgtcgtgaccgacgagaacccgcgctcggaggaccccgcg
agcatccgcgcggcgatcctcgacggggtgcgcaccgtgcgccccgacctgaccgacgtc
ctcgaggtcgagccgcgtgccgaggcggtccgccgcggcgtcgcgctcgcgcgcgagggc
gacaccgtcatcgtgacgggcaagggccacgaaccgacccaggagatcgccggagtgttc
caccggtacaacgaccgtgacgtcctgctcgccgtgcgcgacgagtccgccggagggcac
gcgtga

DBGET integrated database retrieval system