KEGG   Cellvibrio gilvus: Celgi_2157Help
Entry
Celgi_2157        CDS       T01537                                 

Definition
F420-dependent oxidoreductase
Orthology
K12234  
coenzyme F420-0:L-glutamate ligase / coenzyme F420-1:gamma-L-glutamate ligase [EC:6.3.2.31 6.3.2.34]
Organism
cga  Cellvibrio gilvus
Pathway
Methane metabolism
Microbial metabolism in diverse environments
Class
Metabolism; Energy metabolism; Methane metabolism [PATH:cga00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2358137..2358964)
Genome map
AA seq 275 aa AA seqDB search
MSPAPTSDAPGDLRVWAPAGLPEVVPGDDLVALLVGLLRDDAAAHPDRALRDGDILVVTS
KIVSKAEGRVVAADDREQAITDETVRVVATREHAGGVTRIVENRLGLVMAAAGVDASNTP
VGTVLLLPLDPDASARALRAGVGAACGVRIGVLVTDTAGRPWRDGVTDITIGAAGVRVLE
DLRGAHDTQGRPLTMTVTAVGDEVAAAAELVKGKASGRPVAVVRGLASHVLDDDGPGART
LVRLGAQDMFSQGSAEAYAQGWKDALDRPQDAPDR
NT seq 828 nt NT seq  +upstreamnt  +downstreamnt
atgagccctgcgccgacgtccgacgcgcccggcgacctccgcgtctgggcacccgccggg
ctgccggaggtggtgccgggcgacgacctcgtggccctgctcgtcgggctgctgcgcgac
gacgccgccgcgcacccggaccgcgcgctgcgggacggcgacatcctcgtcgtgacgtcc
aagatcgtgtccaaggcggagggacgcgtggtcgccgccgacgaccgcgagcaggcgatc
accgacgagaccgtgcgcgtggtggccacgcgtgagcacgccggcggcgtgacgcgcatc
gtggagaaccggctgggcctggtcatggccgcggcgggggtggatgcgagcaacacgccc
gtcggcaccgtgctgctgctgccgctcgacccggatgcgagcgcgcgggcgctgcgcgcg
ggcgtcggggccgcgtgcggtgtgcggatcggcgtgctggtcacggacaccgcgggccgg
ccgtggcgggacggcgtcacggacatcacgatcggcgccgcgggcgtccgggtgctcgag
gacctgcgcggcgcgcacgacacgcagggccggcccctgacgatgaccgtcacggcggtg
ggcgacgaggtcgcggccgcggccgagctcgtcaagggcaaggcgtcggggcgtcccgtc
gcggtggtgcgcgggctcgcgagccacgtgctggacgacgacggaccgggcgcccgcacg
ctggtgcggctcggcgcgcaggacatgttcagtcagggcagcgccgaggcgtacgcccag
gggtggaaggacgcgctcgaccgcccgcaggacgccccggaccggtga

DBGET integrated database retrieval system