KEGG   Cellulomonas gilvus: Celgi_2201Help
Entry
Celgi_2201        CDS       T01537                                 

Definition
4-alpha-glucanotransferase
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
cga  Cellulomonas gilvus
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cga00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Celgi_2201
Enzymes [BR:cga01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     Celgi_2201
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2407362..2409491)
Genome map
AA seq 709 aa AA seqDB search
MVDDSQAPSEALLRLAAAHGVVPDHWGFHGELRRASAGTLRAVLAALGVDASSPERIDLA
LAHIDDMPWRRTLPPVVVVRSGRSQDVPVHVTHGDPVHVWLQLDPEVGGGRRDLHQADVY
VEPRTVDGRLVGRATFALPDDLPLGWHEIHASGPSGDARAVVVVTPDRLELPAPLQGRRA
WGYMAQLYSVRSRRSWGVGDLADLADLGWLAAHEAGADFLLINPLHAAEPAAPLTPSPYL
PTTRRFVNPLYVRPEAVPEAAYLTAADRALVEWSAESVTGLNLDAGPIDRDAAWNAKRAA
LDVIFAHERSAARQAAFDAFVQEQGPGLRTFALWCALAEKYGSETIPPELADPASPAVAV
EAALLADRVAFHTWLQWVADEQLGAAQAAARAGGMSIGIMHDLAVGVHPAGADAWSLGDV
LARGAEVGAPPDMYNQQGQNWSQPPWRPDALARAAYAPYRDMLRTVLRHAGAIRIDHVLG
LFRLWWIPKGAGADEGAYVRYDHEALVGILALEAHRAGAVVIGEDLGTVEPWVRGYLSER
GILGTSVLWFENGADGQPLPPEDYRPLVLATVTTHDLPPTAGYLAGEHVAIRERLGLLTE
PLAVVRAQADAERERMIGALRARGLVGPDPSEREVVEAMHRYVLATPAVLVGVALADAVG
ERRAQNQPGTDQEYPNWKVPLADSVGQVVLLDDLFTNARLRSLAAVLRG
NT seq 2130 nt NT seq  +upstreamnt  +downstreamnt
gtggtggacgactcgcaggctccctcggaggcgttgctgcgcctcgccgccgcgcacggc
gtggtcccggaccactgggggttccacggcgagctgcgccgcgcatccgccgggacgctg
cgggcggtgctcgcggcgctcggcgtggacgcctcctcgcccgagcgcatcgatctcgcg
ctggcacacatcgacgacatgccgtggcgccgcacgctgccgcccgtcgtcgtcgtgcgg
tcggggcggagccaggacgtgcccgtgcacgtgacgcacggcgacccggtgcacgtgtgg
ttgcagctcgaccccgaggtcggcggcgggcggcgcgacctgcaccaggcggacgtgtac
gtcgagccacgcacggtcgacggccggctggtcggccgtgcgacgttcgcgctgccggac
gacctcccgctcggctggcacgagatccacgcgtcgggaccgagcggggacgcgcgcgcg
gtcgtcgtcgtgacgcccgaccggctcgagctgccggccccgctgcagggccggcgcgcg
tggggctacatggcgcagctgtactcggtgcgctcgcggcgctcgtggggcgtgggcgac
ctggccgacctcgccgacctggggtggctcgcggcgcacgaggcgggcgcggacttcctg
ctcatcaacccgctgcacgccgccgagcccgccgcgccgctcacgccctcgccgtacctg
cccaccacgcggcgcttcgtcaacccgctgtacgtgcgccccgaggcggtgccggaggcg
gcctacctcaccgcggcggaccgcgcgctggtcgagtggtcggccgagtcggtcaccggg
ctcaacctcgacgcgggcccgatcgaccgcgacgccgcgtggaacgccaagcgcgccgcg
ctcgacgtgatcttcgcgcacgagcggtcggccgcacggcaggcagcgttcgacgcgttc
gtccaggagcagggcccggggctgcgcacgttcgcgctgtggtgcgcgctggccgagaag
tacggctccgagaccatcccgcccgagctggccgacccggcctcgcccgcggtcgcggtc
gaggctgcgctgctcgcggaccgggtcgcgttccacacgtggctgcagtgggtggccgac
gagcagctcggggccgcgcaggcggccgcgcgcgccggcggcatgtcgatcgggatcatg
cacgacctggccgtgggcgtgcaccccgcgggtgcggacgcctggtcgctgggcgacgtg
ctggcccgcggcgccgaggtgggtgcaccgcccgacatgtacaaccagcagggccagaac
tggtcgcagccgccctggcgcccggacgcgctggcccgcgcggcgtacgcgccgtaccgg
gacatgctgcgcaccgtgctgcgccacgcgggtgcgatccgcatcgaccacgtcctcggg
ctgttccgcctgtggtggatccccaagggtgcgggcgccgacgagggtgcctacgtccgc
tacgaccacgaggcgctcgtcggcatcctcgcgctcgaggcgcaccgcgcgggcgcggtc
gtgatcggcgaggacctgggcacggtcgagccgtgggtgcggggctacctgtccgagcgc
ggcatcctcggcacgtcggtgctgtggttcgagaacggtgcggacgggcagccgctgccg
cccgaggactaccgcccgctggtgctggccacggtcacgacgcacgacctgccgccgacc
gccgggtacctcgcgggtgagcacgtcgcgatccgggagcggctgggcctgctcaccgag
ccgctcgcggtggtccgggcgcaggccgacgcggagcgggagcggatgatcggcgcgctg
cgggcgcgcgggctcgtcgggccggacccgtccgagcgcgaggtggtcgaggcgatgcac
cggtacgtgctcgccacgccggcggtgctcgtcggcgtcgcgctcgcggacgccgtgggg
gagcgccgcgcgcagaaccagccgggcacggaccaggagtacccgaactggaaggtgccg
ctcgccgactcggtcgggcaggtggtcctgctggacgacctgttcaccaacgcgcgcctg
cgcagcctggccgcggtgctgcgcggctga

DBGET integrated database retrieval system