KEGG   Cellulomonas gilvus: Celgi_2266Help
Entry
Celgi_2266        CDS       T01537                                 

Definition
exodeoxyribonuclease V, alpha subunit
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
cga  Cellulomonas gilvus
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:cga00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Celgi_2266
Enzymes [BR:cga01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     Celgi_2266
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2483715..2485625
Genome map
AA seq 636 aa AA seqDB search
MSHDVTLGGQGAVPGAFPGARDAARAWSGDASPDVPWHTEGLLAPFVAARVLTSADVHVA
RRVTALCGEADESVQLAAALAVRALRAGSVCVVLADVAATVVEPTDDDAGSDPLPAPFPG
TPGVAPEPDGLPWPETGAWTGAVRASPAVADGADGPPDRPLRWTDGRLYLDRYWCDEVEV
AEHVAARLEPVAVDEQRLTAAVQRLFPDAADDRQRAALRTAATSRLTVLTGGPGTGKTTT
VARLVAALQDVAGPGLRVALAAPTGKAAARLQESVTAELQALPLDADRAAAGELRASTVH
RLLGHRPGSSTRFGHDARHRLPHDVVVVDECSMMSLPLMARLLEAVRPQARVVLVGDAHQ
LASVEAGAVLGDLVASLPHGVVELTREHRFGAELAALAHAIREGDADRTVALLTAGGAAV
EWVPTAGDAPTAREAAGLEADVRATGAALVAAARAGAVDDALHALGEHRLLLAHRHGPAG
VAHWTDVVEEWVAQETGGRSAAPYPPGRPLIVTRNDRSTGLYNGDTGVVVETPDGVAVAF
GAPGAHRLVAPYRLPPARSVHAMTVHRGQGSQFTRVSVVLPPAASPLLTRELLYTAVTRA
RTHLRVIGSEAAVRAAVQRPVQRASGLAAGARPVTG
NT seq 1911 nt NT seq  +upstreamnt  +downstreamnt
atgagccacgacgtcacgctcggcggccagggcgccgtgcccggagcgttccccggtgcg
cgtgacgccgcacgcgcgtggtccggcgacgcgtcgccggatgtgccgtggcacaccgag
ggcctgctcgcaccgttcgtcgccgcgcgcgtcctgacgtcggccgacgtgcacgtcgcg
cgccgcgtcaccgcgctgtgcggcgaggccgacgagtcggtgcagctcgccgcggcgctc
gcggtgcgcgcgctgcgcgcgggctcggtgtgcgtggtcctcgcggacgtggcggcgacc
gtggtcgagcccaccgacgacgacgcgggcagcgacccgctcccggccccgttccccggc
acgcccggggtcgcccccgagcccgacggcctgccgtggcccgagacgggcgcgtggacc
ggtgcggtccgcgcgagcccggcggtcgcggacggagccgacggcccgccggaccggccg
ctgcgctggacggacggccgcctctacctggaccgctactggtgcgacgaggtcgaggtc
gccgagcacgtcgccgcgcgtctcgagccggtcgcggtcgacgagcagcgcctcacggcg
gccgtgcagcgcctgttcccggacgccgccgacgaccggcagcgggcggcgctgcggacc
gcggccacgtcccggctcacggtcctcacgggcgggccgggtacgggcaagaccacgacg
gtcgcccggctggtggcggcgctgcaggacgtcgcaggccccgggctgcgggtcgcgctc
gcggcgcccacgggcaaggcggcggcgcgtctgcaggagtcggtcaccgcggagctgcag
gccctgccgctcgacgccgaccgggccgcagcgggcgagctccgcgcgagcacggtccac
cgcctgctcgggcaccgcccgggcagcagcacgcgcttcggccacgacgcgcggcaccgg
ctgccgcacgacgtggtcgtggtcgacgagtgctcgatgatgtcgctcccgctcatggcg
cgcctgctcgaggccgtgcggccgcaggcgcgcgtggtgctggtgggtgatgcgcaccag
ctcgcgagcgtcgaggcgggcgccgtcctcggcgacctggtcgcctcgctcccgcacggc
gtcgtcgagctcacgcgcgagcaccggttcggtgccgagctcgcggccctcgcgcacgcc
atccgggagggcgacgccgaccgcacggtcgcgctgctcacggcgggcggtgcggccgtc
gagtgggtgccgaccgcgggcgacgcgcccaccgcgcgcgaggcggcgggcctcgaggcc
gacgtccgcgcgaccggcgccgcgctggtcgcggcggcccgcgccggtgccgtcgacgac
gcgctgcacgcactcggtgagcaccggctcctgctggcccaccggcacgggcccgcgggc
gtcgcgcactggaccgacgtggtcgaggagtgggtggcgcaggagacgggcggccggtcg
gcagcgccgtacccaccgggccggccgctcatcgtgacgcgcaacgaccggtccacgggc
ctgtacaacggcgacacgggtgtggtcgtggagacgcccgacggcgtcgcggtcgcgttc
ggcgcacccggggcgcaccgcctggtggcgccctaccggctcccgcccgcgcgcagcgtg
cacgcgatgaccgtgcaccgcggccagggcagccagttcacgcgcgtgagcgtggtgctg
ccgccggcggcctccccgctgctgacgcgcgagctgctgtacaccgcggtcacacgggcg
cgcacgcacctgcgcgtgatcggttcggaggccgcggtgcgggccgccgtgcagcgcccc
gtgcagcgtgcgagcggcctcgcggcaggagcacggcccgtcaccgggtga

DBGET integrated database retrieval system