KEGG   Cellvibrio gilvus: Celgi_2269Help
Entry
Celgi_2269        CDS       T01537                                 

Definition
1,4-beta cellobiohydrolase
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
cga  Cellvibrio gilvus
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:cga00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2487996..2489033)
Genome map
AA seq 345 aa AA seqDB search
MTRIRARALLALPVVALLLALAAPTQAAPGAAASAGASDAAPAASVAPRLAQRLYVDTDT
QARAAAKAARAAGRTSVANRLDVIATAPQARWIGDWTGVAGARAEVAAYVKKARAKNQTP
QLVLYAIPNRDCGGHSGGGLTPQTYPKWIAQVALGLRDGAVGGRSEAIVVLEPDALVQDC
DDPTRVPLIKDATAKLAATGAWVYLDAGHSNWRTPADTAARLRAAGVAKARGFATNVSNY
NATSAEQAYAKKVAQQLAAAGVGQAHRHFVIDTSRNGTASARGQWCNPRGQGLGVRPVTK
KDGYLLDALLWVKHPGESDGACNGGPGAGQWWEEIALELVAHRVR
NT seq 1038 nt NT seq  +upstreamnt  +downstreamnt
gtgacccgcatccgcgcccgcgcgctcctggccctgcccgtcgtcgcgctcctgctcgcc
ctggcggcaccgacccaggcggcgcccggtgcggccgcgtcggccggagcctccgacgcg
gccccggccgcgagcgtcgcgccgcgcctcgcgcagcgcctgtacgtggacaccgacacg
caggcccgcgcggccgcgaaggccgcccgcgccgcgggccgcacgagcgtcgcgaaccgg
ctcgacgtcatcgcgaccgcgccgcaggcgcgctggatcggcgactggaccggggtggcc
ggtgcgcgcgccgaggtcgcggcgtacgtgaagaaggcgcgcgccaagaaccagacgccg
cagctggtgctgtatgcgatccccaaccgtgactgcggcgggcactcgggcggcggcctg
acgccgcagacctacccgaagtggatcgcgcaggtcgcgctcgggctgcgggacggcgcg
gtcggcgggcggtcggaggcgatcgtggtgctcgagcccgacgccctggtgcaggactgc
gacgacccgacgcgcgtcccgctcatcaaggacgcgaccgccaagctcgcggcgaccggc
gcgtgggtctacctggacgcgggtcactcgaactggcgcacgcccgccgacaccgccgca
cggctgcgcgccgcgggtgtggccaaggcgcgcgggttcgcgacgaacgtgtccaactac
aacgcgacgtcggccgagcaggcgtacgccaagaaggtcgcgcagcagctcgccgcggcg
ggcgtcggtcaggcgcaccggcacttcgtgatcgacacgtcgcgcaacggcacggcgagc
gcccgcgggcagtggtgcaacccccgggggcaggggctgggcgtgcggcccgtcaccaag
aaggacgggtacctgctcgacgcgctcctgtgggtcaagcaccccggcgagtccgacggc
gcgtgcaacggaggaccgggcgccggtcagtggtgggaggagatcgccctcgagctggtc
gcgcaccgcgtgcgctga

DBGET integrated database retrieval system