KEGG   Cellulomonas gilvus: Celgi_2403Help
Entry
Celgi_2403        CDS       T01537                                 

Definition
glycoside hydrolase 10
Orthology
K01181  
endo-1,4-beta-xylanase [EC:3.2.1.8]
Organism
cga  Cellulomonas gilvus
Brite
Enzymes [BR:cga01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.8  endo-1,4-beta-xylanase
     Celgi_2403
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2640055..2644671)
Genome map
AA seq 1538 aa AA seqDB search
MSRPTARSRASAWTALSALVASSLTAFAAAPAAHAEEAPAPVPVVSNDFESAVAPWGARG
STVAATTTEAHGGSKSLLVSARSASWAGTEADLTSTLVVGEPYEVSAFVKLPAGTAGSSA
VKITAQTNDGSSTSYAQVTEPVTATAEGWLELTGTYVRPAGTTSVVLYVEAADIGTVHPD
LLVDDVEILGAAGGGDGGYVETDPDFVPGGALNAVEAPVTAARGTEKTTALTFDDGPNGA
TTTELLDFLEANDVPATFCVIGQNVEAPGGADVLRRIVADGHTLCNHSTDYSGMGSLTPQ
QVADKLKANLATIRTALGDATAQVPYFRAPNGDWGRTNQVAVALGMQPLAVTNLIMDWDG
AENAGDEAKLTAALRETITSHPGQVVLVHDGGGNRSAGVAAVKTVVAELLADGWTFTLPA
GGAAPRGVTLADSDFEDGTLQGWTPRGDDSGDPTLAVTDELAHESTYAARVSDRTSQGQG
LQIDVTDRATPGATYDVSAWVRFEGTPGDMTLSARGVTDGSATYSNLVQFTGLSSSEWVH
LTGTFTMPAFETAAELYVETKWASGEAGNTSPFVIDDITIASTPPSTVEDLTPLKDTVDF
PVGVAIDSRETAGTASELLLRHFDQVTSENYMKVEAWYAGTGVDTFRLHPEAAALMDYAQ
ANDLAVYGHTLAWHSQTPDWFFEDDEGALLAPEAMRQRLRDHVFAVARTLSEEYGPFGSA
TNPLRAFDVVNEVIDDGTAYADGMRRSTWYQILGEEFVDDAFRYADEAFNDVYAADGVEH
PVTLFINDYNTEQTGKRARYKALVERLLARDVPIDGVGHQFHVALSTPASTLEDAIADFE
DLPVTQAVTELDVVVGSADTAKAIDQGYYYQQAFDAFREHADSLFSVTVWGLTDGRSWRA
SNNGKPLLFDDFFKAKPAFRGAAGLELPAAIRSANAFAADPGGDYAVTSEQWDRLPLHPV
GEDARFQLRWAPDGLTAFVDVDDADVDATDAVVVETTDGPATFGRDGEGDLEGTATERDG
GWTAVVRVPLTDAAQGDVVQLDVQVVDGDVTTTWNTPGVLGSISLVEPLSFVAIHRTDAA
PTIDGDVDAAWTLAGAITTDKVTSGSDGARGTFRTLWRDGTLYVLADVADDVVDTSGSDP
WTKDSVEIYVDAGNAKNGSYRYDDTQIRIDATGAVSFGTGDEAFQRNRLTSAVVETATGY
RVEAAISLLEHGGLGTFHGLDVQVNDAAGGSRHAISNWADPTGAGYQSTAHWGVAELVGP
AVATAPVITEQPVGGTVTLGRTLTLRAAANGAPAPTVQWQRRAPGSPVWTDVPGATSASL
AVVVTAANDGAAYRAVFTNVAGTVRSSAAVVRVTRVAPRITTQPRSVQVAAGTTVTVTAA
ASGYPAPQVRWEKKKAGSSQWVRVEGATRTSLKVTASRSNSGLQVRAVFRNAVGTATTRA
ATITVKPVAPRVSVQPRPTTARAGTVASFTVRVTGFPAPKVQWYERRAGSTTWVKLTGST
SAQLQVLATKARDGALYRAVATNAAGSVTSTAVRLTVR
NT seq 4617 nt NT seq  +upstreamnt  +downstreamnt
atgtcccgacccaccgcacggagtcgcgcgagcgcctggacggcactcagcgcgctcgtc
gcgtccagcctgacggcattcgcggcggcccccgccgcgcacgccgaagaagcccccgcc
cccgtccccgtggtcagcaacgacttcgagtcggccgtcgcaccgtggggcgcgcgtggc
tcgaccgtggccgccaccaccaccgaggcgcacggcggcagcaagagcctgctcgtctcg
gcgcgctccgcgagctgggcgggcaccgaggccgacctgacctccaccctcgtcgtggga
gagccgtacgaggtctccgcgttcgtcaagctcccggccgggaccgcgggctcgtcggcc
gtcaagatcacggcgcagacgaacgacggctcgagcacgtcctacgcgcaggtgaccgag
ccggtcacggcgacggccgagggctggctcgagctcacgggcacgtacgtccgcccggcg
ggcacgacgtccgtggtgctgtacgtcgaggccgcggacatcggcacggtccaccccgac
ctcctggtcgacgacgtggagatcctcggcgcggcgggcggtggcgacggcggctacgtc
gagacggaccccgacttcgtgcccggtggtgcgctcaacgccgtcgaggcgcccgtgacg
gcggcccgcggcaccgagaagaccacggcgctgacgttcgacgacggcccgaacggcgcg
acgaccaccgagctgctcgacttcctcgaggcgaacgacgtgccggccacgttctgcgtg
atcgggcagaacgtcgaggcgccgggcggcgcggacgtgctgcgccggatcgtcgcggac
ggccacacgctgtgcaaccacagcaccgactacagcggcatgggctcgctcacgccgcag
caggtcgcggacaagctcaaggcgaacctcgcgaccatccggaccgcgctgggtgacgcg
accgcgcaggtgccgtacttccgcgcaccgaacggcgactggggccggaccaaccaggtg
gcggtcgcgctcggcatgcagccgctcgcggtgacgaacctgatcatggactgggacggc
gcggagaacgcgggcgacgaggcgaagctgaccgccgcgctgcgcgagaccatcacgtcc
cacccgggccaggtcgtgctcgtgcacgacggcggcggcaaccggagcgcaggtgtcgcc
gcggtcaagaccgtggtcgccgagctgctcgccgacggctggacgttcacgctgcccgcg
ggcggcgccgcaccgcgtggtgtgacgctggcggactcggacttcgaggacggcacgctg
cagggctggacgccccgcggcgacgacagcggcgaccccacgctggccgtgaccgacgag
ctcgcgcacgagagcacgtacgcggcgcgcgtctccgaccgcacgtcgcagggccagggc
ctgcagatcgacgtcaccgaccgggcgaccccgggcgcgacgtacgacgtctcggcgtgg
gtccggttcgagggcacgccgggggacatgacgctctcggcgcgcggtgtgaccgacggc
agcgcgacctactccaacctggtccagttcacggggctctcctcgagcgagtgggtgcac
ctgaccgggacgttcaccatgccggcgttcgagaccgccgccgagctgtacgtcgagacg
aagtgggccagcggtgaggcgggcaacacgtcgccgttcgtgatcgacgacatcacgatc
gcctcgaccccgccgtcgaccgtcgaggacctcacgccgctcaaggacacggtcgacttc
ccggtcggtgtggccatcgactcgcgcgagaccgcgggcaccgcctcggagctgctgctc
cggcacttcgaccaggtgaccagcgagaactacatgaaggtcgaggcctggtacgcgggc
acgggcgtggacacgttccgcctgcaccccgaggccgccgccctgatggactacgcgcag
gccaacgacctggccgtctacggccacacgctcgcgtggcacagccagacgcccgactgg
ttcttcgaggacgacgagggtgcgctgctcgcgcccgaggcgatgcggcagcgcctgcgc
gaccacgtgttcgcggtcgcccggacgctgagcgaggagtacgggccgttcggctcggcc
accaacccgctgcgcgcgttcgacgtggtcaacgaggtgatcgacgacggcaccgcgtac
gccgacggcatgcgccgcagcacgtggtaccagatcctcggtgaggagttcgtcgacgac
gcgttccgctacgccgacgaggcgttcaacgacgtgtacgcggcggacggcgtcgagcac
cccgtgacgctgttcatcaacgactacaacaccgagcagacgggcaagcgcgcgcgctac
aaggcgctcgtcgagcggctgctcgcgcgtgacgtcccgatcgacggcgtgggccaccag
ttccacgtcgcgctgtccacgccggcgagcacgctcgaggacgccatcgcggacttcgag
gacctgcccgtcacgcaggcggtcaccgagctcgacgtcgtcgtcggctcggcggacacc
gcgaaggcgatcgaccagggctactactaccagcaggcgttcgacgcgttccgggagcac
gcggacagcctgttctcggtcacggtctggggactgaccgacgggcgctcgtggcgcgcg
tcgaacaacggcaagccgctgctgttcgacgacttcttcaaggccaagcccgcgttccgc
ggcgcggccggcctcgagctgcccgcggcgatccgctcggcgaacgcgttcgcggcggac
cccggtggtgactacgcggtgacgtcggagcagtgggaccggctgccgctgcacccggtg
ggcgaggacgcccgcttccagctgcggtgggcgcccgacgggctcacggccttcgtcgac
gtcgacgacgccgacgtcgacgcgaccgacgcggtcgtcgtcgagaccacggacggcccg
gccacgttcggccgcgacggcgagggcgacctcgagggcaccgccaccgagcgtgacggc
gggtggaccgcggtggtccgggttcccctgaccgatgcggcgcagggtgacgtggtccag
ctcgacgtgcaggtggtcgacggtgacgtcacgacgacgtggaacacgccgggcgtgctc
ggcagcatctcgctcgtcgagccgctgtcgttcgtcgcgatccaccgcacggacgcggcc
ccgacgatcgacggcgacgtcgacgcggcgtggacgctggccggggcgatcaccacggac
aaggtgacgtcgggctccgacggcgcccggggcacgttccgcacgctgtggcgggacggc
acgctgtacgtcctggcggacgtggccgacgacgtggtcgacacgtcgggatcggacccg
tggaccaaggactcggtggagatctacgtcgacgccgggaacgccaagaacggctcctac
cggtacgacgacacgcagatccggatcgacgcgaccggtgcggtctcgttcggcacgggc
gacgaggcgttccagcgcaaccggctgacgagcgcggtcgtcgagacggcgacggggtac
cgggtggaggcggcgatcagcctgctcgagcacggcggcctcgggacgttccacggcctg
gacgtgcaggtcaacgacgccgcgggcggcagccggcacgcgatcagcaactgggcggac
cccacgggtgcgggctaccagtccacggcccactggggcgtcgccgagctcgtcggaccc
gcggtcgccaccgcacccgtgatcaccgagcagcccgtgggcggcacggtgacgctgggc
cggacgctcacgctgcgcgcggccgcgaacggggcacccgcgccgaccgtgcagtggcag
cggcgtgcacccggctcgccggtgtggacggacgtgccgggcgcgacgagcgcgagcctc
gccgtcgtcgtcaccgcggcgaacgacggcgcggcctaccgtgcggtcttcaccaacgtg
gccggcaccgtccggtcctcggcggccgtcgtcagggtgacccgtgtcgcaccgcggatc
accacccagccgcggtccgtccaggtcgcggcgggcaccacggtgaccgtcacggccgcg
gcgtcgggctacccggcaccgcaggtccgctgggagaagaagaaggcgggctcgtcgcag
tgggtccgggtcgagggagccacgaggaccagcctcaaggtcacggcctcgcgctcgaac
agcggcctgcaggtgcgtgcggtgttccgcaacgcggtgggcacggccacgacgagggcg
gcgaccatcacggtcaagccggtcgcgccgcgcgtctcggtccagccgaggcccaccacg
gcccgcgccggcacggtcgcgtcgttcacggtccgggtgacggggttccccgcaccgaag
gtccagtggtacgagcggcgcgcgggctccacgacgtgggtgaagctcacggggtcgacg
tccgcgcagctccaggtgctggcgacgaaggcccgtgacggggcgctgtaccgcgcggtg
gcgaccaacgccgccggctcggtcaccagcacggcggtgcgcctgacggtgcgctga

DBGET integrated database retrieval system