KEGG   Cellulomonas gilvus: Celgi_2417Help
Entry
Celgi_2417        CDS       T01537                                 

Definition
(GenBank) phosphofructokinase
  KO
K21071  ATP-dependent phosphofructokinase / diphosphate-dependent phosphofructokinase [EC:2.7.1.11 2.7.1.90]
Organism
cga  Cellulomonas gilvus
Pathway
cga00010  Glycolysis / Gluconeogenesis
cga00030  Pentose phosphate pathway
cga00051  Fructose and mannose metabolism
cga00052  Galactose metabolism
cga00680  Methane metabolism
cga01100  Metabolic pathways
cga01110  Biosynthesis of secondary metabolites
cga01120  Microbial metabolism in diverse environments
cga01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:cga00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Celgi_2417
   00030 Pentose phosphate pathway
    Celgi_2417
   00051 Fructose and mannose metabolism
    Celgi_2417
   00052 Galactose metabolism
    Celgi_2417
  Energy metabolism
   00680 Methane metabolism
    Celgi_2417
Enzymes [BR:cga01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Celgi_2417
    2.7.1.90  diphosphate---fructose-6-phosphate 1-phosphotransferase
     Celgi_2417
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK NAD_kinase P_gingi_FimA
Motif
Other DBs
NCBI-ProteinID: AEI12916
UniProt: F8A1X2
Position
complement(2659113..2660237)
Genome map
AA seq 374 aa AA seqDB search
MASKRVGILTAGGDSPGLNAAIRGFGKTAIGHYGMELIGFRDGITGLVEDRFVELDGAAL
SGILTVGGTILGTSRDKVHRWNVDGEVRDMVPTVVENYHRNGLDALIMLGGGGTAKNAMR
LVDAGLNVITLPKTIDNDIARTDTTFGFATAMEIATEAIDRVHSTAHSHHRIILTEIMGH
RAGWLTLGAGIAGGADVILLPEIPYTVDSIAATIKARTARGSTFSVIAVAEGARDVDDTA
DYQAAQLLVKAAKTPEAVRAAKAHLKHVEDAQREHTFTLARELEAATGLESRVTILGYVQ
RGGTPCAADRLLASRLGAAAADLVNRGEFGVMVASRNEGTEAVPLSEVAGKVKLVPPDHA
WIAAARQVGTGLGD
NT seq 1125 nt NT seq  +upstreamnt  +downstreamnt
atggccagcaagcgcgtcggcatcctcaccgcgggcggcgacagccctggcctgaacgcc
gcgatccgcgggttcggcaagaccgccatcgggcactacggcatggagctgatcggcttc
cgcgacggcatcaccgggctcgtcgaggaccggttcgtcgagctcgacggtgcggcgctg
tccggcatcctcacggtcggcggcacgatcctgggcaccagccgggacaaggtgcaccgg
tggaacgtggacggcgaggtgcgggacatggtcccgacggtggtggagaactaccaccgc
aacgggctcgacgcgctcatcatgctgggcggcggcggcaccgcgaagaacgcgatgcgc
ctggtcgacgcggggctgaacgtcatcacgctgcccaagacgatcgacaacgacatcgcc
cggacggacacgacgttcgggttcgcgacggcgatggagatcgcgaccgaggcgatcgac
cgcgtgcactcgaccgcgcacagccaccaccggatcatcctcaccgagatcatggggcac
cgcgccggctggctcacgctcggtgcgggcatcgcgggcggcgcggacgtcatcctcctg
cccgagatcccgtacacggtggactcgatcgcggcgaccatcaaggcgcgcacggcccgc
ggcagcacgttctcggtcatcgcggtcgccgagggtgcgcgcgacgtcgacgacaccgcg
gactaccaggccgcgcagctgctggtgaaggccgccaagacgcccgaggccgtgcgggcc
gccaaggcgcacctcaagcacgtcgaggacgcgcagcgggagcacaccttcacgctggcg
cgtgagctggaggccgccacggggctcgagtcgcgcgtcacgatcctcgggtacgtgcag
cgcggtggcacgccgtgcgcggccgaccgcctgctcgcatcccggctgggcgccgccgcg
gccgacctggtcaaccgcggcgagttcggcgtcatggtcgcctcccgcaacgaggggacc
gaggccgtgccgctgagcgaggtggccggcaaggtcaagctggtgccgcccgaccacgcc
tggatcgccgcggcccgccaggtcgggaccggcctgggcgactga

DBGET integrated database retrieval system