KEGG   Cellulomonas gilvus: Celgi_2432Help
Entry
Celgi_2432        CDS       T01537                                 

Definition
1,4-alpha-glucan branching enzyme
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
cga  Cellulomonas gilvus
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Trehalose biosynthesis, D-glucose 1P => trehalose
Brite
KEGG Orthology (KO) [BR:cga00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Celgi_2432
Enzymes [BR:cga01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     Celgi_2432
Exosome [BR:cga04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Celgi_2432
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2680802..2682988
Genome map
AA seq 728 aa AA seqDB search
MSPAVPSPVPVETDTLRAVAHGSWYDPHGVLGAHVGYGGVTVRTLRPLADAVVIITPETR
VPARHEQDGIWVAVLPGDSVPDYRIEVTYGGTTTLTDDPYRYLPTVQELDRHLIREGRHE
ALWTVLGANVRTYPGLLGQVDGTAFAVWAPNARAVRVVGDFNYWQGAAHAMRSLGDSGVW
ELFVPGVTAGARYKFEILTQDGTWRQKADPMARGTEVPPATASVVVESTYTWGDDAWLEA
RAAHDPHTAPLSVYEVHLGSWRAGLSYRELAHQLTEYVVDLGFTHVELLPVAEHPYAPSW
GYQVTGYYAPSSRFGHPDDLRYLIDTLHRAGVGVIVDWVPGHFPKDEWALAQFDGTALYE
HPDPLIGEQPDWGTYVFNFGRNEVRNFLVANAVYWLTEFHVDALRVDAVASMLYLDYSRQ
PGQWRPNKHGGRENLEAIAFLQETNATAYRHAPGIMMIAEESTAWPGVTAPTDHNGLGFG
LKWNMGWMNDTLRYMAEEPVHRRYHHGEITFSMVYAYSERYILPISHDEVVHGKGSLYGR
MPGDHWQKTAGVRTLLAYQWTHPGKQLLFMGQEFAQPDEWSESRSLDWWALQDPLRAGVQ
RMVRDLNALYRRTPALWQLDHTPDGFEWIDSNDADHNVLAYVRKGVDCPPVVVVVNFAGV
AHENYRLALPSGGRWAEIFNTDVLEYGGSGVGNLGAVQAQPDPHHGRPASALVRVPPYGV
ILLSPEQG
NT seq 2187 nt NT seq  +upstreamnt  +downstreamnt
atgagcccggccgtcccgtcccccgtccccgtcgagaccgacacgctgcgcgccgtggcg
cacgggtcctggtacgacccgcacggcgtgctcggtgcgcacgtcgggtacggcggggtc
acggtccgcacgctgcgcccgctcgcggatgcggtggtgatcatcacgcccgagacgcgt
gtgcccgcgcggcacgagcaggacggcatctgggtcgcggtgctgccgggcgactcggtg
cccgactaccggatcgaggtcacgtacggcggcacgacgacgctcaccgacgacccgtac
cgctacctgccgaccgtgcaggagctcgaccggcacctgatccgcgagggccggcacgag
gcgctgtggaccgtgctcggcgcgaacgtgcgcacataccccgggctgctcggacaggtc
gacggcaccgcgttcgcggtgtgggcgccgaacgcccgggccgtgcgcgtggtcggcgac
ttcaactactggcagggcgccgcgcacgccatgcgctcgctgggcgactcgggcgtgtgg
gagctgttcgtgcccggcgtgaccgcgggtgcgcggtacaagttcgagatcctcacgcag
gacggcacgtggcggcagaaggccgacccgatggcgcgcggcaccgaggtcccgccggcc
accgcgtcggtcgtcgtcgagtcgacgtacacgtggggcgacgacgcgtggctcgaggca
cgcgccgcgcacgacccgcacaccgctcccctgtcggtgtacgaggtgcatctcggctcg
tggcgcgccggtctgtcctaccgcgagctcgcgcaccagctcaccgagtacgtcgtcgac
ctcgggttcacgcacgtcgagctgctcccggtcgcggagcacccgtacgcaccctcgtgg
ggctaccaggtcacggggtactacgcgccctcgtcgcggttcggccaccccgacgacctg
cgctacctcatcgacacgctgcaccgcgcgggcgtcggcgtcatcgtcgactgggtcccg
ggtcacttccccaaggacgagtgggcgctcgcgcagttcgacggcaccgcgctgtacgag
cacccggacccgctcatcggcgagcagccggactggggcacgtacgtgttcaacttcggc
cgcaacgaggtgcgcaacttcctcgtcgcgaacgccgtgtactggctcacggagttccac
gtggacgcgctgcgcgtggacgcggtcgcctccatgctctacctcgactactcgcgccag
ccgggccagtggcggcccaacaagcacggcggccgcgagaacctcgaggcgatcgcgttc
ctgcaggagaccaacgcgacggcctaccgccacgcaccgggcatcatgatgatcgccgag
gagtccaccgcgtggcccggcgtgaccgcacccaccgaccacaacggcctgggtttcggc
ctgaagtggaacatgggctggatgaacgacacgctgcggtacatggcggaggagccggtg
caccggcgctaccaccacggcgagatcacgttctcgatggtctacgcgtactccgagcgc
tacatcctgccgatctcgcacgacgaggtggtgcacggcaaggggtccctgtacgggcgc
atgcccggcgaccactggcagaagaccgcgggcgtgcgcacgctgctcgcctaccagtgg
acgcaccccggcaagcagctgctgttcatggggcaggagttcgcccagcccgacgagtgg
agcgagtcccggtcgctcgactggtgggccctgcaggaccccctgcgcgccggggtgcag
cgcatggtccgggacctcaacgcgctctaccgacgcacacccgcgctgtggcagctggac
cacacgcccgacggcttcgagtggatcgactcgaacgacgccgaccacaacgtgctcgcg
tacgtgcgcaagggcgtcgactgcccgcccgtggtcgtcgtcgtgaacttcgcgggggtc
gcgcacgagaactaccggctcgcgctcccgtcgggcggccgctgggccgagatcttcaac
acggacgtgctcgagtacggcgggtccggggtcgggaacctgggtgccgtgcaggcccag
cccgacccgcaccacggccggcccgcctccgcactcgtgcgcgtcccgccgtacggcgtc
atcctgctctcccccgagcagggctga

DBGET integrated database retrieval system