KEGG   Cellvibrio gilvus: Celgi_2437Help
Entry
Celgi_2437        CDS       T01537                                 

Definition
Beta-galactosidase
Orthology
K12308  
beta-galactosidase [EC:3.2.1.23]
Organism
cga  Cellvibrio gilvus
Pathway
Galactose metabolism
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:cga00052]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2690307..2692352)
Genome map
AA seq 681 aa AA seqDB search
MSLSSWPTGSAISFGGDYNPEQWSRDVWDEDVALMRQAGVNLVSVGIFSWGMLEVSEGVF
DFAWLDELLDLLHANGIAVDLGTPTASPPAWFFAQYPQARVVAKDGTVQGFGSRGMASPS
SPEYRAAAVRIATELAQRYAQHPAVVLWHVHNEYGAPVGEDFSPAAVTAFRVWLQARYGS
LDELNAAWGTAFWGQRYTRWEHVGLPHATPSVANPAQRLDFARFSDHQLRACYIAERDAI
RAHATQPITTNFMANECPGTDLFAWAREVDVVANDHYLTAADPRGHVGLALAADLTRSVA
GGAPWLLMEHSTSAVNWQPRNVAKRAGEMARNSLSHLARGADGILFFQWRASRSGAEKFH
SAMLPHAGTDSRVWREVVELGHSLQRLAPVQGSRVHADVAILWDAESFWAQDLEWRPSVD
VQHRERVRAYYERLWRDGLTIDFVQPSQDLSGYRLVVAPASYLLRVQDAANLTAFVADGG
TLLVSFFSGIVDEHDAVHQGGFLAPLREALGLTVEEFLPLRAGETARVSWTPDGAQAQEL
PADVWQDDIALDGAQVVGTYLDGPAAGRPAITRNAHGAGSAWYVSTRLDIDALAPVMERV
YADARLAPAGLPFDVEVVTRRGADADFVVAINHSAEDVDLALGDGQELLGAAPVSGTLVV
PAGSVAVLRTDARRVGGDGQP
NT seq 2046 nt NT seq  +upstreamnt  +downstreamnt
atgtctctctcgagctggcccactggcagcgcgatctcgttcggcggcgactacaacccc
gagcagtggtcgcgcgacgtctgggacgaggacgtcgcactcatgcgccaggccggtgtc
aacctcgtgagcgtcgggatcttctcgtggggcatgctcgaggtcagcgagggcgtgttc
gacttcgcctggctcgacgagctgctcgacctgctgcacgccaacggcatcgcggtggac
ctgggcacgcccaccgcctcgccgccggcctggttcttcgcgcagtacccgcaggcgcgc
gtggtcgccaaggacggcaccgtgcagggcttcggctcgcgcggcatggcctccccgagc
tcgccggagtaccgcgcggcagcggtccgcatcgcgacggagctcgcgcagcggtacgcg
cagcaccccgcggtcgtgctctggcacgtgcacaacgagtacggtgccccggtgggcgag
gacttctcgcccgcggcggtcacggcgttccgggtgtggctgcaggcgcgctacggctcg
ctcgacgagctgaacgcggcgtgggggaccgcgttctggggtcagcgctacacgcggtgg
gagcacgtcggcctgccgcacgcgacgccgtccgtggccaaccccgcgcagcgcctggac
ttcgcgcggttcagcgaccaccagctgcgcgcgtgctacatcgcggagcgcgatgcgatc
cgggcgcacgcgacgcagccgatcaccaccaacttcatggccaacgagtgccccgggacg
gacctgttcgcgtgggcccgcgaggtggacgtggtcgcgaacgaccactacctgacggcg
gcggacccgcgcggccacgtgggcctggcgctggccgcggacctcacgcggtcggtcgcg
ggcggtgcgccgtggctgctcatggagcactcgacctcggcggtcaactggcagccgcgc
aacgtcgccaagcgtgcgggggagatggcgcgcaactcgctctcgcacctggcgcgcggt
gcggacgggatcctgttcttccagtggcgggcctcgcgctcgggcgcggagaagttccac
tcggcgatgctgccgcacgccgggaccgactcgcgcgtgtggcgcgaggtcgtggagctg
gggcactcgttgcagcggctcgcgcccgtgcagggctcgcgggtgcacgccgacgtcgcg
atcctgtgggacgccgagtcgttctgggcgcaggacctggagtggcggccgtcggtggac
gtgcagcaccgcgagcgcgtgcgcgcgtactacgagcggctctggcgtgacggcctgacg
atcgacttcgtgcagccgtcgcaggacctgtccggctaccgcctggtggtcgcgcccgcg
tcctacctgctgcgtgtgcaggacgccgcgaacctcacggcgttcgtcgcggacggtggc
acgctgctcgtctcgttcttctcgggcatcgtcgacgagcacgacgcggtgcaccagggc
ggcttcctcgccccgctgcgcgaggcgctcgggctcacggtcgaggagttcctgccgctg
cgcgccggggagaccgcacgcgtctcctggacgccggacggggcgcaggcccaggagctg
cccgccgacgtgtggcaggacgacatcgcgctggacggcgcgcaggtcgtcggtacctac
ctcgacggacccgccgcgggccggcccgcgatcacgcggaacgcccacggcgccggatcg
gcgtggtacgtctcgacgcggctcgacatcgacgcactggcaccggtcatggagcgcgtg
tacgccgacgcgcggctcgcgcccgcgggcctgccgttcgacgtcgaggtcgtcacgcgc
cggggcgcggacgcggacttcgtcgtcgcgatcaaccactccgccgaggacgtcgacctc
gccctcggcgacggccaggagctgctcggcgccgccccggtctcgggcacgctcgtcgtc
cccgcaggttcggtggccgtgctccgcacggacgcccggcgtgtcggaggtgatggccag
ccgtag

DBGET integrated database retrieval system