KEGG   Cellulomonas gilvus: Celgi_2449Help
Entry
Celgi_2449        CDS       T01537                                 

Definition
Beta-galactosidase
Orthology
K12308  
beta-galactosidase [EC:3.2.1.23]
Organism
cga  Cellulomonas gilvus
Pathway
Galactose metabolism
Brite
KEGG Orthology (KO) [BR:cga00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    Celgi_2449
Enzymes [BR:cga01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     Celgi_2449
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2712713..2714788)
Genome map
AA seq 691 aa AA seqDB search
MSPTHGLHALTQARGVLYGGDYNPEQWPREVWREDVALMREAGVNLVTVGVFSWSVLEPE
PGVLDFGWLDEVLGLLADADIAVDLATPSASAPPWLARLHPESSSVDARGVRMAVGSRNH
FCPSAPAYRDAALRVARALAHRYAGHPALALWHVGNEYGQECFCDLCADRWRAWLAARYG
DVARLNDAWGTAFWSQRYGALEEVVPPRAAPYLHNPAQAVDWRRFTSDQMRALYREQAAV
LRAAGDVPVTTNFMGFFGGVDQHTWTDDLDVVADDHYGDPQDPASPARSALTHDLTRGVG
RGAPWLLMEQAAGAVNWRPHNVPKTPAQMLQDSLRAVAHGADGVCYFQWRASAAGAESFH
SALLPHAGPDTVLHRAVRAQGRALAALRPVVGARVPARAALVHDWPALWAGELPARPSDR
LRVLDQLEAYHRPLWRAGIATDVVPSTAPLDGYDLVVVPALPLVSDAAAAAIAAVPQRGG
VLVVGPFSGVQDPTTRVRTGAFPAPWTGVLGLAGEEWRPLPDAGVPVRSERYGDFVASTW
SERLRADDADVLATYAGADLEGAPAVLRRADPSGGQAWYVSTLPPQDVLDRVLRDAADAA
GLRPPLPGAPDDVEVAVRGGLVFVLNLAAEPRVVPLPRSDGPVRDLLGGVVVDGRITLPA
GGAAVLEHAPAASPDPAHDDVVVEPTDHPED
NT seq 2076 nt NT seq  +upstreamnt  +downstreamnt
atgagccccacgcacgggctgcacgcgctcacgcaggcccgcggcgtgctctacggcggc
gactacaaccccgagcagtggccgcgcgaggtgtggcgtgaggacgtcgcgctcatgcgc
gaggcgggggtcaacctggtcacggtcggcgtcttctcctggtcggtcctcgagcccgag
ccgggtgtcctcgacttcggctggctcgacgaggtgctgggcctgctggccgatgcggac
atcgcggtggacctggcgaccccctcggcgtccgcgccgccctggctggcgcggctgcac
cccgagtcgtcctcggtggacgcgcgcggcgtgcgcatggcggtcggctcgcgcaaccac
ttctgcccgtcggcgcccgcctaccgggacgccgcgctgcgcgtggcgcgtgcgctcgcg
caccggtacgcgggccaccccgcgctcgcgctgtggcacgtgggcaacgagtacggccag
gagtgcttctgcgacctgtgcgcggaccgctggcgcgcgtggctcgccgcgcggtacggc
gacgtggcccggctcaacgacgcgtggggcaccgcgttctggagccagcggtacggcgcg
ctcgaggaggtggtcccgccgcgcgcggcgccctacctgcacaaccccgcgcaggcggtg
gactggcgccgcttcacgtccgaccagatgcgtgcgctgtaccgcgagcaggcggccgtg
ctccgcgcggccggcgacgtgccggtcaccacgaacttcatgggcttcttcgggggagtc
gaccagcacacgtggacggacgacctcgacgtcgtcgccgacgaccactacggcgacccg
caggacccggcaagcccggcgcgctccgcgctcacgcacgacctcacgcgcggcgtcggc
cgcggcgcgccctggctgctcatggagcaggccgcgggtgccgtcaactggcggccgcac
aacgtcccgaagaccccggcccagatgctgcaggactcgctgcgtgccgtggcgcacggc
gcggacggcgtctgctacttccagtggcgcgcctcggcggcgggagccgagagcttccac
tccgcgctgctgccccacgccgggccggacaccgtgctgcaccgcgcggtgcgtgcgcag
ggccgggcgctcgccgcgctgcgacccgtggtgggggcccgcgtgcccgcccgggcggcg
ctcgtgcacgactggcccgcgctgtgggcgggtgagctgcccgcgcggccgtccgaccgc
ctgcgcgtcctggaccagctcgaggcgtaccaccgtccgctgtggcgcgcgggcatcgcg
accgacgtggtgccgtccaccgcgccgctcgacggctacgacctggtggtggtgccggca
ctgccgctcgtgagcgacgccgcggccgccgcgatcgccgccgtgccgcagcgcggcggc
gtcctggtcgtcggcccgttcagcggcgtccaggacccgaccacgcgcgtccgcacggga
gccttccccgcgccgtggaccggtgtgctggggctggccggcgaggagtggcgccccctg
cccgacgcgggcgtccccgtgcgcagcgagcggtacggcgacttcgtcgcgtccacgtgg
tccgagcggctgcgcgccgacgacgccgacgtgctcgcgacgtacgccggggccgacctc
gagggcgcccccgcggtcctgcgccgtgccgacccgagcggcgggcaggcgtggtacgtc
tcgacgctcccgccccaggacgtgctggaccgtgtgctgcgcgacgccgccgacgcggcc
gggctccggccgccgctgcccggcgcacccgacgacgtcgaggtggcggtccgcggcggg
ctggtgttcgtgctgaacctggccgccgagccgcgcgtcgtgccgctgccgcgctcggac
ggtccggtgcgcgacctgctcggcggcgtggtcgtcgacggtcggatcacgctgcccgcg
ggcggcgccgccgtgctcgagcacgcaccggccgcatcccctgaccccgctcacgacgac
gtcgtcgtcgagccgaccgaccaccccgaggactga

DBGET integrated database retrieval system