KEGG   Cellulomonas gilvus: Celgi_2479Help
Entry
Celgi_2479        CDS       T01537                                 

Definition
threonine synthase
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
cga  Cellulomonas gilvus
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:cga00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Celgi_2479
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Celgi_2479
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Celgi_2479
Enzymes [BR:cga01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Celgi_2479
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2746077..2747168)
Genome map
AA seq 363 aa AA seqDB search
MAHQWRGVIAEYADRLPAHLLTHPVTLGEGGTPLIAAPALSERTGADVHVKFEGMNPTGS
FKDRGMTTAISAAAARGAKAVVCASTGNTSASAAAYATRAGMVCAVLVPDGKIAMGKLSQ
AIAHGARLLQVDGNFDACLVAARKLAEAYPVDLVNSVNPDRIQGQKTAAFEIVDALGDAP
DIHVLPVGNAGNITAYWKGFREYAGLDDGAAHGTVASRTPVMWGFQAAGAAPLVLGHPVD
EPETIATAIRIGNPASWDQALEARDVSGGIIESVTDDEILRAHRVLSAEVGVFVEPASAA
GVAGLLRLSDEGRVPAGARITITVTGHGLKDPQWALRGPDGSDVTPVRVSADVVSIADAL
GLG
NT seq 1092 nt NT seq  +upstreamnt  +downstreamnt
atggcccaccagtggcgcggcgtcatcgccgagtacgccgaccgcctgcccgcgcacctg
ctgacgcaccccgtcacgctcggcgaggggggcacgccgctgatcgccgcgcccgccctg
agcgagcgcacgggtgcggacgtgcacgtgaagttcgagggcatgaaccccacgggctcg
ttcaaggaccgcggcatgaccaccgcgatctcggccgcggcggcgcgcggcgcgaaggcc
gtggtgtgcgcctcgacgggcaacacgtcggcgtccgcggccgcgtacgcgacacgtgcg
ggcatggtctgcgcggtcctggtgcccgacggcaagatcgcgatgggcaagctcagccag
gcgatcgcgcacggcgcgcgcctgctgcaggtggacggcaacttcgacgcgtgcctggtg
gcggcgcgcaagctcgccgaggcctacccggtggacctggtgaactcggtcaaccccgat
cgcatccagggccagaagaccgcggcgttcgagatcgtggacgcgctcggcgacgcgccg
gacatccacgtgctccccgtcggcaacgcgggcaacatcacggcgtactggaaggggttc
cgcgagtacgcgggcctcgacgacggtgcggcgcacggcacggtcgcgagccgcacgccg
gtgatgtggggcttccaggccgcgggcgccgcgccgctggtgctgggccaccccgtggac
gagccggagacgatcgcgaccgcgatccgcatcggcaaccccgcgtcgtgggaccaggcg
ctcgaggcgcgcgacgtctcgggcgggatcatcgagtcggtcaccgacgacgagatcctg
cgcgcgcaccgcgtgctgtccgccgaggtcggggtgttcgtcgagcccgcgtccgccgcg
ggcgtcgcgggcctgctgcgcctgtccgacgagggccgcgtgcccgccggcgcgcgcatc
acgatcaccgtcaccgggcacggcctcaaggacccgcagtgggcgctgcgcggccccgac
ggcagcgacgtcaccccggtgcgcgtgagcgcggacgtggtgtccatcgcggacgccctc
ggcctgggctga

DBGET integrated database retrieval system