KEGG   Cellulomonas gilvus: Celgi_2487Help
Entry
Celgi_2487        CDS       T01537                                 

Definition
iron-containing alcohol dehydrogenase
Orthology
K04072  
acetaldehyde dehydrogenase / alcohol dehydrogenase [EC:1.2.1.10 1.1.1.1]
Organism
cga  Cellulomonas gilvus
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Pyruvate metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:cga00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    Celgi_2487
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Celgi_2487
   00620 Pyruvate metabolism
    Celgi_2487
   00650 Butanoate metabolism
    Celgi_2487
  Lipid metabolism
   00071 Fatty acid degradation
    Celgi_2487
  Amino acid metabolism
   00350 Tyrosine metabolism
    Celgi_2487
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Celgi_2487
   00626 Naphthalene degradation
    Celgi_2487
Enzymes [BR:cga01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     Celgi_2487
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     Celgi_2487
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2756474..2759218
Genome map
AA seq 914 aa AA seqDB search
MTTTSTTRPSKGRKADAEAVAAPAAAPAPAPSQDEVAGTIDALVANAAKALAQFESMTQE
DVDRFVKKGAVAALDQHGQLAKLAVDETGRGVFEDKAVKNIFACEHVTNSMANLKTVGVI
NVDEINGITEIAEPVGVIAGITPVTNPTSTAIFKSLISLKTRNPIIFAFHPNAQKSSMAA
AKIVRDAAVAAGAPEHCIQWVEAPSLAATGALMNHPGVATILATGGNAMVKAAYSCGKPA
LGVGAGNVPAYIEKTAKLARAVNDVVLSKAFDNGVICASEQAVIIDDEIYDAAMVEFTKL
HAYRTNAAEKAALERFIFGAEAGGENCAGAKLNPAVVGKSPVWIAEQAGFTVPADTSIIL
AEVSGVGPHEPLTREKLCPVLAVLRSTSTEEGMTLAEKMVEFDGLGHSAAIHTQDEALTI
EFGKRVKAIRVICNAPSSLGGIGDIYNAFIPSLTLGCGSYGHNSVSNNVSAVNLINVKRV
GRRNNNLQWFKVPAKTYFEPNAIRYLADMPDVERVTIVTDATMTTLGFVDKVLDVLHRRG
NNVAVQIIDEVEPEPSVRTVQKGAASMRHFKPDTIIALGGGSPMDAAKVMWLLYEHPEIN
FSDLKQKFFDVRKRAFKFPTLGELAHLVCIPTTSGTGAEVTPFAVISDPDAGKKYPLADY
ALTPTVAIIDPILTSKMPRSLAADSGFDALTHATEAFVSVYANDFTDGMALQAIRLIFDN
LAQSVNGDPAEPATKDAREKMHNAGTIAGMAFGNAFLGIVHAMAHVVGSTFHLVHGRTNA
TLLPHVIRYNGTIPTKLTSWPKYESYVAPERFQQIAQMLGLPAATPEQGVESYAQAVESL
RAKVGIPSSFQAQGVDEQDFIGRLDEVAMGAYEDQCAPANPRMPMIDDMKSILTAAYYGT
SLEDVRGRTGEKKG
NT seq 2745 nt NT seq  +upstreamnt  +downstreamnt
gtgaccaccaccagcaccacccgtccgtccaagggtcgcaaggccgacgccgaggcagtc
gcggcgcccgcagcggcgcccgcgcccgccccctcgcaggacgaggtcgccggcacgatc
gacgcgctcgtcgccaacgcggccaaggccctcgcgcagttcgagtccatgacccaggag
gacgtggaccgcttcgtcaagaagggcgcggtcgccgcgctcgaccagcacggtcagctc
gccaagctcgcggtcgacgagaccggccgcggtgtcttcgaggacaaggccgtcaagaac
atcttcgcgtgcgagcacgtgaccaactcgatggccaacctcaagaccgtcggcgtcatc
aacgtcgacgagatcaacggcatcaccgagatcgcggagcccgtcggcgtcatcgcgggc
atcacgccggtcaccaaccccacgtcgaccgcgatcttcaagtcgctgatctcgctcaag
acgcgcaacccgatcatcttcgcgttccacccgaacgcgcagaagtcctcgatggccgcc
gcgaagatcgtgcgcgacgccgccgtggccgcgggtgcgcccgagcactgcatccagtgg
gtcgaggccccgtcgctcgccgcgaccggtgcgctcatgaaccacccgggtgtcgcgacg
atcctggcgaccggcggcaacgccatggtcaaggccgcctactcgtgcggcaagccggcc
ctgggcgtcggtgcgggcaacgtgcccgcctacatcgagaagacggccaagctggcccgc
gcggtcaacgacgtcgtgctctccaaggcgttcgacaacggcgtgatctgcgcctccgag
caggccgtcatcatcgacgacgagatctacgacgccgcgatggtcgagttcaccaagctg
cacgcgtaccgcaccaacgcggccgagaaggccgccctcgagcgcttcatcttcggtgcc
gaggccggtggcgagaactgcgcgggcgccaagctcaacccggcggtcgtcggcaagtcg
cccgtgtggatcgccgagcaggccggcttcacggtccccgcggacacgtcgatcatcctc
gccgaggtctccggcgtcggcccgcacgagccgctgacgcgcgagaagctgtgcccggtc
ctcgcggtgctgcgctcgacctccaccgaggagggcatgacgctcgccgagaagatggtc
gagttcgacggcctgggccactcggccgcgatccacacgcaggacgaggcgctgaccatc
gagttcggcaagcgcgtcaaggccatccgcgtcatctgcaacgcgccgtcgtcgctcggt
ggcatcggtgacatctacaacgccttcatcccctcgctgacgctcggctgcggctcctac
ggccacaactcggtgtccaacaacgtctcggcggtgaacctcatcaacgtcaagcgcgtg
ggtcgtcggaacaacaacctgcagtggttcaaggtgccggcgaagacctacttcgagccg
aacgccatccgctacctcgccgacatgcccgacgtcgagcgcgtcacgatcgtcaccgac
gcgaccatgacgaccctcggcttcgtcgacaaggtcctcgacgtcctgcaccgccgcggc
aacaacgtcgccgtgcagatcatcgacgaggtcgagcccgagccgtccgtgcgcaccgtg
cagaagggcgccgcgagcatgcggcacttcaagccggacacgatcatcgcgctcggcggt
ggctcgcccatggacgccgccaaggtcatgtggctgctgtacgagcaccccgagatcaac
ttctcggacctcaagcagaagttcttcgacgtccgcaagcgcgcgttcaagttcccgacg
ctcggcgagctggcccacctggtctgcatcccgacgacgtccggcacgggcgccgaggtc
acgccgttcgcggtcatctccgaccccgacgcgggcaagaagtacccgctggccgactac
gcgctgaccccgacggtcgcgatcatcgacccgatcctcacgtcgaagatgccccgttcg
ctggccgccgactcgggcttcgacgccctgacgcacgccaccgaggcgttcgtctcggtc
tacgccaacgacttcaccgacggcatggcgctgcaggcgatccgcctcatcttcgacaac
ctggcgcagtcggtgaacggcgaccccgcggagcccgccaccaaggacgcccgcgagaag
atgcacaacgccggcacgatcgcgggcatggcgttcggcaacgcgttcctcgggatcgtg
cacgccatggcgcacgtcgtcggctcgacgttccacctggtccacggccggacgaacgcc
acgctgctcccccacgtgatccgctacaacggcacgatcccgaccaagctcaccagctgg
ccgaagtacgagagctacgtcgcaccggagcggttccagcagatcgcccagatgctgggt
ctgccggccgccacgccggagcagggtgtggagtcctacgcccaggccgtggagtcgctg
cgcgccaaggtcggcatcccgtcgtccttccaggcgcagggcgtcgacgagcaggacttc
atcggtcgcctcgacgaggtcgccatgggcgcctacgaggaccagtgcgcacctgccaac
ccccgcatgccgatgatcgacgacatgaagtcgatcctgacggcggcctactacggaacg
tcgctggaggacgtccggggccgcacgggcgagaagaagggctga

DBGET integrated database retrieval system