KEGG   Cellulomonas gilvus: Celgi_2514Help
Entry
Celgi_2514        CDS       T01537                                 

Definition
pyrimidine-nucleoside phosphorylase
Orthology
K00758  
thymidine phosphorylase [EC:2.4.2.4]
Organism
cga  Cellulomonas gilvus
Pathway
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cga00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    Celgi_2514
Enzymes [BR:cga01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.4  thymidine phosphorylase
     Celgi_2514
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2787169..2788461)
Genome map
AA seq 430 aa AA seqDB search
MSETFDAVDVIVAKRDGKRLTDAQIDWVIDAYTRGVVADEQMSALNMAILLNGMDRAEIA
RWTAAMIASGERMSFADLGRPTSDKHSTGGVGDKITLPLAPLVAVFGVAVPQLSGRGLGH
TGGTLDKLESIPGWRAALTNDEMMRQLADVGAVICQAGSGLAPADRKLYALRDVTGTVEA
IPLIASSIMSKKIAEGTGSLVLDVKVGSGAFMKDLERARELARTMVELGTDAGVTTVALL
TDMSTPLGLTAGNALEVRESVEVLAGGGPADVVELTVALAREMLAAAGQPDADPAAALAD
GRAMDVWRRMIAAQDGDPDAELPVARETEQVLAESDGVLTTLDAFGVGVAAWRLGAGRAR
KEDPVQAGAGVEIHVRPGEPVRAGQPVLTLHTDTPERFARAKEALAGAIVVDPTAAPGAG
PLLLDRITAS
NT seq 1293 nt NT seq  +upstreamnt  +downstreamnt
atgagcgagacgttcgacgcggtcgacgtcatcgtcgccaagcgggacggcaagcgcctg
accgacgcgcagatcgactgggtgatcgacgcgtacacgcgcggcgtggtcgccgacgag
cagatgtccgcgctcaacatggcgatcctgctcaacggcatggaccgcgcggagatcgcg
cggtggaccgcggcgatgatcgcgtcgggtgagcgcatgtccttcgcggacctgggccgg
ccgacgtccgacaagcactcgacgggcggcgtgggggacaagatcacgctcccgctcgcg
ccgctcgtcgcggtgttcggcgtcgcggtgccgcagctgtccgggcgcggcctgggccac
acgggcggcacgctcgacaagctcgagtcgatccccgggtggcgcgcggcgctgaccaac
gacgagatgatgcgtcagctcgcggacgtcggtgcggtgatctgccaggccgggtcgggg
ctcgcgcccgcggaccgcaagctctacgcgctgcgggacgtgaccgggaccgtcgaggcc
atcccgctgatcgcgagctcgatcatgagcaagaagatcgcggagggcaccggctcgctc
gtgctcgacgtcaaggtcggttcgggtgcgttcatgaaggacctggagcgcgcgcgtgag
ctcgcccgcaccatggtcgagctcggcaccgacgcgggcgtcacgacggtcgcgctgctg
accgacatgtccacgccgctgggcctgaccgcgggcaacgcgctcgaggtccgggagtcg
gtcgaggtgctcgccggcggtgggcccgcggacgtcgtggagctcacggtcgcgctcgcg
cgcgagatgctcgcggccgcggggcagcccgacgcggaccccgccgccgcgctggccgac
ggccgggcgatggacgtgtggcggcgcatgatcgcggcgcaggacggcgaccccgacgcg
gagctgccggtggcgcgcgagaccgagcaggtgctcgcggagtccgacggcgtgctgacg
acgctcgacgcgttcggcgtcggcgtggcggcgtggcggctcggtgcgggccgtgcgcgc
aaggaggacccggtgcaggccggtgcgggcgtggagatccacgtgcgcccgggtgagccc
gtccgcgccggtcagcccgtgctcacgctgcacaccgacaccccggagcggttcgcgcgc
gccaaggaggcgctcgccggtgcgatcgtggtggacccgacggccgcgcccggcgccggt
ccgctgctgctggaccgcatcacggcgtcctga

DBGET integrated database retrieval system