KEGG   Cellvibrio gilvus: Celgi_2523Help
Entry
Celgi_2523        CDS       T01537                                 

Definition
succinate dehydrogenase hydrophobic anchor subunit-like protein
Orthology
K00242  
succinate dehydrogenase membrane anchor subunit
Organism
cga  Cellvibrio gilvus
Pathway
Citrate cycle (TCA cycle)
Oxidative phosphorylation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Succinate dehydrogenase, prokaryotes
Class
Metabolism; Overview; Carbon metabolism [PATH:cga01200]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:cga00020]
Metabolism; Carbohydrate metabolism; Butanoate metabolism [PATH:cga00650]
Metabolism; Energy metabolism; Oxidative phosphorylation [PATH:cga00190]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2797433..2797891
Genome map
AA seq 152 aa AA seqDB search
MTTIADPKAPRPPRARPARLTTRGNTELYGWIFMRASGALLLVLIFGHLFVNLVAGDGVK
AIDFGFVAGKWASPLWQVWDLLMLWLAMIHGTNGMRTIVNDYAEKDSTRLVLKGLLYLAF
VVTVVLGTLVIFTFDPCPTDAPLDLLPSFCTA
NT seq 459 nt NT seq  +upstreamnt  +downstreamnt
atgaccacgatcgcggatcccaaggcgccgcgtcccccgcgcgcccgtccggcacggctg
accacgcgcggcaacaccgagctctacggctggatcttcatgcgcgcgtcgggcgcgctg
ctgctcgtcctgatcttcggccacctgttcgtcaacctcgtcgccggtgacggcgtcaag
gccatcgacttcgggttcgtcgccggcaagtgggcctcgccgctgtggcaggtctgggac
ctgctgatgctgtggctcgcgatgatccacggcaccaacggcatgcgcacgatcgtcaac
gactacgccgagaaggacagcacgcgcctggtgctcaagggcctgctgtacctcgcgttc
gtcgtgaccgtggtcctggggacgctcgtgatcttcacgttcgacccgtgccccaccgac
gcgccgctggacctgctgccgtcgttctgcaccgcctga

DBGET integrated database retrieval system