KEGG   Cellvibrio gilvus: Celgi_2539Help
Entry
Celgi_2539        CDS       T01537                                 

Definition
dihydropteroate synthase
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
cga  Cellvibrio gilvus
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:cga00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2811897..2812820)
Genome map
AA seq 307 aa AA seqDB search
MTVAGVPAAGAVLRLRGRELGPDRPVVMAVVNRTTDSFYAAARYDEAGADAAVARAAEEG
ADLVDLGGVRAGRGPRVAAQEEIARVVPLVERVRARHPELLVSVDTWRSSVARAAAQAGA
DLVNDTWAGHDPELVAVAAEHGLGVVCSHTGGARPRTDPFRVTYPADPQRVADPLDGVVD
DVVVTLAAAARRAVDLGIDPASVLVDPTHDFGKTTWHSLHLVRRTQALVALGHPVLMALS
RKDFVGESLDLPPEERLEGTLAATAVAAWLGARVFRTHDVRATRRTLDMVATIRADRPPA
AAVRGLA
NT seq 924 nt NT seq  +upstreamnt  +downstreamnt
gtgaccgtcgcgggggtgcccgcggccggtgcggtgctccggctgcgcggtcgagagctg
ggccccgaccgtccggtggtcatggcggtcgtcaaccgcaccacggactcgttctacgcg
gccgcgcggtacgacgaggcgggcgcggacgccgcggtcgcgcgtgccgccgaggagggt
gcggacctggtggacctcggcggcgtgcgcgcggggcgcgggccccgggtggcggcgcag
gaggagatcgcgcgcgtggtcccgctggtcgagcgcgtgcgggcgcggcaccccgagctg
ctggtcagcgtggacacgtggcgctcgtcggtggcgcgcgccgccgcgcaggcgggtgcg
gacctggtcaacgacacgtgggcggggcacgaccccgagctggtcgcggtcgcggccgag
cacggcctcggcgtggtctgctcgcacacgggcggcgcccggccccgcacggacccgttc
cgcgtgacgtacccggcggacccgcagcgcgtggcggacccgctcgacggcgtggtcgac
gacgtcgtcgtgacgctcgcggccgcggcacgccgggccgtggacctggggatcgacccc
gcgagcgtgctcgtggacccgacgcacgacttcggcaagacgacgtggcactcgctccac
ctggtgcgccggacgcaggcgctcgtcgcgctcggccacccggtgctcatggcgctgtcc
cgcaaggacttcgtgggcgagagcctggacctgccacccgaggagcgcctcgagggcacg
ctggccgcgaccgcggtggccgcgtggctcggtgcgcgcgtgttccgtacgcacgacgtg
cgggcgacgcgtcgcacgctcgacatggtcgcgaccatccgcgcggaccggccgcccgcg
gcggccgtgcgggggctggcgtga

DBGET integrated database retrieval system