KEGG   Cellvibrio gilvus: Celgi_2570Help
Entry
Celgi_2570        CDS       T01537                                 

Definition
alpha-galactosidase
Orthology
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
cga  Cellvibrio gilvus
Pathway
Galactose metabolism
Glycerolipid metabolism
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:cga00052]
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:cga00561]
Metabolism; Lipid metabolism; Sphingolipid metabolism
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2842223..2844349)
Genome map
AA seq 708 aa AA seqDB search
MSLIHLRAAGVSLLLTSDDDRLPTVVHWGRDLGELPPELLADLVRASEVPLAGAQVDAPR
PVGVLPGQSDGWLGTPGVAGHRDGGAWSPAFVVTDTQVEDAGGHGGRVLAAAEDEHAGLR
LTLELELTAQGVVRTRATLTNSGPDGYVVDALLPALPVPAHAGEILDLAGRWAKERAPQR
HAFTVGTHVREGRRGRTGADATLVLVAGEPGAGFRRGECWGVHVAWSGNHRTQAERMPDG
TRLLAGGELLLPGEVRLAAGEQYASPWLYGTYGDGLDELAGRFHALLRARPQHPTTPRPV
TLNVWEAVYFDHALPRLLELAELAAAVGVERYVLDDGWFRGRRDDTAGLGDWFVDEDVWP
DGLTPLAERVHALGMQLGLWFEPEMVNPDSDLARAHPDWILQVPGRLPPEARHQQVLDVS
RPEVFAYLRERVVAVVREYGVDYVKWDHNRDLVEAGAGPAGAPRVHAHTLAVYALLDAIR
ADCPGLEIESCSSGGARVDLGILERTDRVWASDCIDAHERQEIQRWTAQLLPPELVGSHV
GSRTAHTTGRVLDLSFRAATALLGSFGIEWDLTQASPEERAELAAWITLYQQERALLHGG
TTVRDDVPDAGLWLHGVVAPDASRAIYALVQRERPATWPPGRVRLPGLDPDATYVVAPFG
PYAPHNAWDRPRWWGAPVRLTGRALALVGVQSPALEVDHAALLTATRV
NT seq 2127 nt NT seq  +upstreamnt  +downstreamnt
atgagcctgatccacctgcgcgccgcgggcgtgagcctgctgctgacgtccgacgacgac
cgcctgcccaccgtcgtgcactggggccgcgacctgggcgagctgccgcccgagctgctc
gccgacctggtccgcgcgagcgaggtgccgctggcgggcgcacaggtggacgcgccgcgc
ccggtcggcgtgctgcccgggcagtccgacggctggctcggcacgccgggagtggcgggc
caccgggacgggggcgcgtggtcgcccgcgttcgtcgtcacggacacgcaggtcgaggac
gcgggcgggcacggcggccgcgtgctggccgcggccgaggacgagcacgcggggctgcgc
ctcacgctcgagctcgagctcaccgcgcagggcgtggtccgcacgcgcgcgacgctgacc
aactccggtcccgacggctacgtggtcgacgcgctgctgccggcgctcccggtgcccgcg
cacgcgggggagatcctcgacctcgcgggccggtgggccaaggagcgcgcgccgcagcgg
cacgcgttcacggtgggcacgcacgtgcgcgagggtcggcgcggccgcaccggcgcggac
gcgacgctcgtgctggtcgccggtgagcccggcgccgggttccggcgcggcgagtgctgg
ggcgtgcacgtcgcgtggtccggcaaccaccgcacgcaggccgagcgcatgcccgacggg
acgcgcctgctggcgggcggcgagctgctgctgcccggtgaggtccggctggccgcgggc
gagcagtacgcctcgccgtggctgtacggcacgtacggcgacggcctggacgagctcgcg
gggcggttccacgcgctcctgcgcgcgcgcccgcagcacccgacgacaccgcgcccggtc
acgctcaacgtgtgggaggccgtgtacttcgaccacgcgctcccgcggctgctcgagctc
gcggagctcgcggcggccgtgggcgtcgagcggtacgtgctcgacgacgggtggttccgc
gggcgccgcgacgacaccgcggggctcggcgactggttcgtcgacgaggacgtgtggccc
gacggcctcacgccgctcgcggaacgcgtgcacgcgctgggcatgcagctgggtctgtgg
ttcgagcccgagatggtcaacccggactccgacctggcgcgcgcgcacccggactggatc
ctgcaggtgccgggccggctgccgcccgaggcgcggcaccagcaggtgctcgacgtgtcc
cggcccgaggtgttcgcctacctgcgcgagcgcgtggtcgccgtggtgcgtgagtacggc
gtggactacgtgaagtgggaccacaaccgcgacctggtcgaggccggtgcgggtcccgcg
ggtgcgccgcgcgtgcacgcgcacacgctcgcggtgtacgcgctgctggacgcgatccgc
gcggactgcccggggctcgagatcgagtcgtgctcgtcgggcggggcgcgcgtggacctc
ggcatcctcgagcgcaccgaccgcgtgtgggcgtccgactgcatcgacgcccacgagcgg
caggagatccagcgctggaccgcgcagctgctgccgcccgagctcgtcggatcgcacgtg
ggctcgcgcacggcgcacaccacggggcgcgtgctcgacctgtccttccgggccgcgacc
gcgctgctcgggtcgttcggcatcgagtgggacctcacgcaggcctcgccggaggagcgc
gccgagctcgcggcgtggatcacgctctaccagcaggagcgcgcgctcctgcacggcggg
accacggtgcgtgacgacgtgccggacgccgggctgtggctgcacggcgtggtcgcgccc
gacgcgtcacgcgcgatctacgcgctggtgcagcgtgagcgccccgccacgtggcctccg
ggtcgcgtgcggctcccgggcctcgacccggacgcgacctacgtggtggcgccgttcggt
ccgtacgcgccccacaacgcgtgggaccgcccgcggtggtggggcgcgccggtccgcctg
acgggccgcgcgctcgcgctcgtcggcgtgcagtcgcccgcgctcgaggtggaccacgcg
gcgctgctcaccgcgacgcgggtgtga

DBGET integrated database retrieval system