KEGG   Cellulomonas gilvus: Celgi_2636Help
Entry
Celgi_2636        CDS       T01537                                 

Definition
acetate/CoA ligase
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
cga  Cellulomonas gilvus
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:cga00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Celgi_2636
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Celgi_2636
   00620 Pyruvate metabolism
    Celgi_2636
   00640 Propanoate metabolism
    Celgi_2636
  Energy metabolism
   00680 Methane metabolism
    Celgi_2636
Enzymes [BR:cga01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     Celgi_2636
Lipid biosynthesis proteins [BR:cga01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Celgi_2636
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2937436..2939424
Genome map
AA seq 662 aa AA seqDB search
MSDPTAGGLENLLSEDRRFAPSAEFVAQANAHGDLYSWANADRPAFWAEQARELITWSTP
FEQVLDWSDAPVARWFADGRLNAAYNAVDRHVAAGRGDRVALHFEGEAGDTRTLTYADLQ
REVSKAANALTALGVATGDRVAIYLPLIPEAVITMLACARIGAPHSVVFGGFSAEALHSR
ILDAEARLVVTADGGFRRGAPSALKPAVDEALAKGPTTVEHVLVVRRTGQDVEWTDGRDV
WWSDVVDAASDEHEPVEVEAEHPLFILYTSGTTGKPKGIFHTTGGYLTQAAYTHLNVFDL
KPETDVYWCTADVGWITGHTYVVYGPLLNGATQVIYEGTPDTPHRGRWWEIVEKYKVSIL
YTAPTAIRTCMKWGDEIPATFDLSSLRVLGSVGEPINPEAWMWYRRVIGGDRTPIVDTWW
QTETGAIMISPLPGVTETKPGSAQVALPGIAADVVDDEAHPVPNGSGGYLVVTEPWPSML
RGIWGDRQRYVDTYWSRFRDLYFAGDGAKKDADGDIWLLGRVDDVMNVSGHRLSTTEIES
ALVSHPWVAEAAVVGAADETTGQAVVAFVILRGDAGVGDTSPDDVQAQLRAHVAKEIGPI
AKPRQVLVVPELPKTRSGKIMRRLLRDVAEHRQVGDATTLADSSVMDLIARGLATPAASS
DG
NT seq 1989 nt NT seq  +upstreamnt  +downstreamnt
gtgtccgacccgaccgccggtggcctggagaacctgctctccgaggatcgccgcttcgcc
ccgtccgccgagttcgtcgcccaggccaacgcgcacggcgacctgtactcgtgggccaac
gccgaccgtccggccttctgggccgagcaggcacgtgagctgatcacgtggagcacgccg
ttcgagcaggtgctcgactggtcggacgcccccgtggcccgctggttcgccgacggccgg
ctcaacgccgcctacaacgcggtggaccggcacgtggcggccgggcggggtgaccgcgtc
gcgctgcacttcgagggcgaggcgggcgacacgcgcacgctcacgtacgccgacctgcag
cgcgaggtctccaaggcggcgaacgcgctgacggcgctcggcgtggcgaccggcgatcgc
gtggcgatctacctgccgctgatcccggaggccgtgatcacgatgctcgcgtgcgcgcgg
atcggcgcgccgcactcggtggtgttcggcggcttctccgccgaggccctgcacagccgc
atcctcgacgcggaggcgcggctcgtggtgaccgcggacggcggcttccggcgtggcgca
ccgtccgcgctcaagcccgcggtcgacgaggcgctggccaagggtccgacgacggtcgag
cacgtcctggtggtccggcgcacggggcaggacgtcgagtggaccgacgggcgcgacgtg
tggtggtcggacgtggtcgacgccgcgtccgacgagcacgagccggtcgaggtggaggcc
gagcacccgctgttcatcctctacacctcgggcaccacggggaagcccaagggcatcttc
cacaccacgggcgggtacctgacgcaggcggcgtacacgcacctcaacgtgttcgacctc
aagccggagaccgacgtgtactggtgcacggcggacgtcggctggatcaccgggcacacg
tacgtcgtctacggcccgctgctcaacggcgcgacgcaggtgatctacgagggcaccccg
gacacgccgcaccgcgggcggtggtgggagatcgtcgagaagtacaaggtgtcgatcctg
tacacggctcccaccgcgatccgcacgtgcatgaagtggggcgacgagatccccgcgacg
ttcgacctgtcgagcctgcgcgtgctcggctcggtgggcgagcccatcaaccccgaggcg
tggatgtggtaccgccgcgtgatcggcggcgaccgcacgccgatcgtcgacacgtggtgg
cagaccgagacgggcgcgatcatgatcagcccgctgccgggcgtcacggagacgaagccc
gggtcggcgcaggtcgcactgccgggcatcgccgcggacgtcgtcgacgacgaggcccac
ccggtcccgaacggctcgggcggctacctggtggtgaccgagccgtggccgtcgatgctg
cgcggcatctggggcgaccggcagcgctacgtggacacgtactggtcccgcttccgggac
ctgtacttcgcgggcgacggcgccaagaaggacgccgacggcgacatctggctgctgggt
cgcgtggacgacgtgatgaacgtgtcggggcaccgcctgtcgaccaccgagatcgagtcc
gcgctggtctcgcacccgtgggtcgcggaggcggccgtggtgggcgcggccgacgagacg
acgggtcaggcggtggtcgcgttcgtcatcctgcgcggcgacgcgggcgtcggtgacacg
tcgcccgacgacgtccaggcgcagctgcgggcccacgtggccaaggagatcggcccgatc
gccaagccgcgtcaggtgctggtggtgcccgagctgcccaagacgcgctcgggcaagatc
atgcgtcgtctgctgcgggacgtggccgagcaccgccaggtgggcgacgcgacgacgctc
gcggactcctcggtcatggacctgatcgcccgcggcctggccaccccggcggcctcgtcg
gacggctga

DBGET integrated database retrieval system