KEGG   Cellulomonas gilvus: Celgi_2718Help
Entry
Celgi_2718        CDS       T01537                                 

Definition
1,4-beta cellobiohydrolase
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
cga  Cellulomonas gilvus
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cga00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Celgi_2718
Enzymes [BR:cga01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     Celgi_2718
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3016138..3017466)
Genome map
AA seq 442 aa AA seqDB search
MHTRRTALALLSATALAVSGLTLAASGAQAADGCRVDYAITSQWTGGFQADVKVTNLGSP
VSSWNVAWSFPAGQTLTQAWNGNATTNGSNVSVTNVGWNGALATGASAAFGFVGSWSGSN
PKPTAFTVNGVACTGTVPTSTPTTSPTPTPTPTPTTTTPPPQPTGSLYVDPTTQAYRAWQ
SASGTDKTLIEKIALTPQSYWVGNWTDAAHAQAEVRDYTGRATAAGKVPTLVVYAIPGRD
CGSYSGGGVAESEYARWIDTIAAGISGNPIVVLEPDALAQLGDCSGQGDRVGFLRYAAKA
LTLKGAKVYIDAGHASWLSVDTAVNRLNQIGFQYAVGFALNTSNYQTTSASQAYGEQISQ
RLGGKGYVIDTSRNGNGSNGEWCNPRGRALGDKPRLVNDSTGLDALLWVKLPGESDGTCN
GGPAAGQWWQEIALELARNAKW
NT seq 1329 nt NT seq  +upstreamnt  +downstreamnt
atgcacacccgtagaaccgcgctcgcgctgctctccgctaccgcactggccgtctcgggc
ctgacgctcgccgcgtcgggcgcccaggccgccgacggctgccgggtcgactacgcgatc
accagccagtggaccggcggcttccaggccgacgtcaaggtcaccaacctgggctcaccc
gtctcgtcgtggaacgtcgcctggtcgttccccgcgggtcagacgctcacgcaggcgtgg
aacggcaacgccacgacgaacggctcgaacgtctcggtgacgaacgtcggctggaacggc
gcgctcgccacgggcgcgagcgccgcgttcggcttcgtcggctcgtggtccggctcgaac
cccaagccgaccgccttcacggtcaacggcgtcgcgtgcaccggcacggtcccgacgagc
acgccgacgacgagcccgacgccgacccccacgccgacgcccacgaccacgacgccgccc
ccgcagcccacgggcagcctgtacgtggacccgacgacgcaggcgtaccgcgcctggcag
agcgcgtccggcaccgacaagacgctcatcgagaagatcgcgctcacgccgcagtcgtac
tgggtgggcaactggaccgacgccgcgcacgcgcaggccgaggtccgcgactacaccggc
cgcgcgacggccgcgggcaaggtccccacgctcgtcgtgtacgcgatcccgggtcgtgac
tgcgggtcctactccggcggcggcgtcgccgagtccgagtacgcgcgctggatcgacacg
atcgcggccggcatcagcggcaacccgatcgtcgtgctcgagcccgacgcgctcgcgcag
ctgggcgactgctcgggccagggtgaccgcgtcggcttcctgcggtacgccgcgaaggcg
ctcacgctcaagggcgcgaaggtctacatcgacgcgggtcacgcgtcgtggctctcggtg
gacaccgcggtgaaccgcctcaaccagatcggcttccagtacgcggtgggcttcgcgctc
aacacgtcgaactaccagaccacgtcggccagccaggcgtacggcgagcagatctcgcag
cggctgggcggcaagggctacgtgatcgacacgtcccgcaacggcaacggctccaacggc
gagtggtgcaacccgcgcggccgtgcgctcggcgacaagccgcgcctggtgaacgactcc
acgggtctggacgcgctgctgtgggtcaagctgcccggcgagtccgacggcacgtgcaac
ggcgggcccgcggcgggtcagtggtggcaggagatcgcgctcgagctcgcgcgcaacgcc
aagtggtga

DBGET integrated database retrieval system