KEGG   Cellulomonas gilvus: Celgi_2857Help
Entry
Celgi_2857        CDS       T01537                                 

Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
cga  Cellulomonas gilvus
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:cga00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Celgi_2857
DNA repair and recombination proteins [BR:cga03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      Celgi_2857
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3152632..3153240)
Genome map
AA seq 202 aa AA seqDB search
MVVVYEGAVQDLIDELGRLPGVGPKSAQRIAFHLLAADPADVRRLADALIEVKERVQFCE
ICGNVAQEPQCRICRDPRRSPTALCVVEEAKDVVAIERTREFRGRYHVLGGAINPIAGVG
PDDLRIAQLMRRLTDGTVTEVILATDPNVEGEATATYLARLLLPMGLTVSRLASGLPVGG
DLEYADEVTLGRAFEGRRLLSA
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
gtggtcgtcgtgtacgagggcgcggtccaggacctgatcgacgagctcgggcggttgccc
ggcgtcggtcccaagagtgcccagcgcatcgcgttccacctgctcgcggccgacccggcg
gacgtccggcggctcgctgacgcgctcatcgaggtcaaggagcgcgtccagttctgcgag
atctgcggcaacgtcgcgcaggagccgcagtgccgcatctgccgtgacccgcggcgctcg
ccgaccgctctgtgcgtggtcgaggaggccaaggacgtcgtcgcgatcgagcgcacgcgc
gagttccgcgggcggtaccacgtgctcggcggcgccatcaacccgatcgcgggggtcggc
ccggacgacctgcgcatcgcgcagctcatgcgccggctgacggacggcacggtcaccgag
gtgatcctggccacggacccgaacgtcgagggtgaggcgaccgcgacgtacctcgcgcgg
ctgctgctgcccatggggctgacggtcagccgcctcgcgtcgggcctgccggtgggtggg
gacctggagtacgcggacgaggtcacgctgggccgggccttcgagggccggcgcctgctg
agcgcgtga

DBGET integrated database retrieval system