KEGG   Cellvibrio gilvus: Celgi_2857Help
Entry
Celgi_2857        CDS       T01537                                 

Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
cga  Cellvibrio gilvus
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:cga03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3152632..3153240)
Genome map
AA seq 202 aa AA seqDB search
MVVVYEGAVQDLIDELGRLPGVGPKSAQRIAFHLLAADPADVRRLADALIEVKERVQFCE
ICGNVAQEPQCRICRDPRRSPTALCVVEEAKDVVAIERTREFRGRYHVLGGAINPIAGVG
PDDLRIAQLMRRLTDGTVTEVILATDPNVEGEATATYLARLLLPMGLTVSRLASGLPVGG
DLEYADEVTLGRAFEGRRLLSA
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
gtggtcgtcgtgtacgagggcgcggtccaggacctgatcgacgagctcgggcggttgccc
ggcgtcggtcccaagagtgcccagcgcatcgcgttccacctgctcgcggccgacccggcg
gacgtccggcggctcgctgacgcgctcatcgaggtcaaggagcgcgtccagttctgcgag
atctgcggcaacgtcgcgcaggagccgcagtgccgcatctgccgtgacccgcggcgctcg
ccgaccgctctgtgcgtggtcgaggaggccaaggacgtcgtcgcgatcgagcgcacgcgc
gagttccgcgggcggtaccacgtgctcggcggcgccatcaacccgatcgcgggggtcggc
ccggacgacctgcgcatcgcgcagctcatgcgccggctgacggacggcacggtcaccgag
gtgatcctggccacggacccgaacgtcgagggtgaggcgaccgcgacgtacctcgcgcgg
ctgctgctgcccatggggctgacggtcagccgcctcgcgtcgggcctgccggtgggtggg
gacctggagtacgcggacgaggtcacgctgggccgggccttcgagggccggcgcctgctg
agcgcgtga

DBGET integrated database retrieval system