KEGG   Cellvibrio gilvus: Celgi_3103Help
Entry
Celgi_3103        CDS       T01537                                 

Definition
protoporphyrinogen oxidase
Orthology
K00231  
oxygen-dependent protoporphyrinogen oxidase [EC:1.3.3.4]
Organism
cga  Cellvibrio gilvus
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Heme biosynthesis, glutamate => protoheme/siroheme
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:cga00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3420746..3422212
Genome map
AA seq 488 aa AA seqDB search
MSTPAPDDRPGTPPKPAADERWGAVVVGGGVAGLVAARELARAGVRTLVVEGRDAVGGAV
RGHVVGGLRLDAGAESYATRGGAVAAYLEDLGLADAIVAPGPLGSWVQLPGGAGPLPRTG
LLGIPSSPWSADTRRTLGWAGAARASLDLVLPRRVGARAGSLGALVRARMGERVLARLVR
PVVGGVHAADPDDLAVDAVSPGLPAALREHRSLARAVRQLRAAAPAGAAVQGLAGGMHVM
VDALADDVLAHGGALRVRTRAVATRPGRLVAVELSDGTVVHAERLVVAAPASADLLRPLL
SADGDAQDEVLGFDDGADVRLVTLVLDAPELDAAPRGTGVLVAREVEQVAAKALTHGTAK
WPWLAAATPPGTHVVRLSYGRSDDEPADDSPAGPDARPELVARALADARVLLGVPLRDEQ
VLASAVVRWTQSLPRPSARHRDATAALRAAVAARPDGTRVAVCGAWVAGNGLASVIPDAV
AAARTVLD
NT seq 1467 nt NT seq  +upstreamnt  +downstreamnt
gtgagcacccccgcgcccgacgaccgccccggcacgcccccgaagccagccgccgacgag
cgctggggggcggtggtggtcggcggcggggtcgcgggcctggtcgcggcgcgcgagctc
gcgcgcgcgggtgtgcgcacgctcgtcgtcgagggacgcgacgccgtgggtggtgcggtg
cgcgggcacgtcgtgggcggcctgcgcctggacgcgggtgccgagtcgtacgccacgcgt
ggcggggcggtggcggcctatctcgaggacctgggtctcgcggacgcgatcgtggctccc
gggccgctcgggtcctgggtgcagctaccgggcggggccggcccgctgccgcgcaccggg
ctgctgggcatcccgtcgagcccgtggtcggcggacacccgccgcacgctcggctgggcg
ggcgcggcgcgcgcgagcctggacctggtgctgccgcgccgggtgggtgcgcgggcgggc
agcctgggcgcgctggtccgggcgcgcatgggtgagcgcgtgctcgcacgcctggtccgg
ccggtggtgggcggtgtgcatgccgcggacccggacgacctcgcggtggacgccgtctcc
ccggggctgcccgcggcgctgcgcgagcaccgctcgctggcccgcgcggtgcggcagctg
cgtgccgccgccccggcgggcgccgcggtgcagggcctggccggcggcatgcacgtgatg
gtcgacgcgctcgcggacgacgtcctggcccacggcggggcgctgcgcgtgcgcacgcgc
gcggtcgcgacccggcccgggcggctggtcgcggtcgagctgtccgacggcacggtggtg
cacgccgagcgtctggtggtcgcggctcccgcctcggcggacctgctgcgcccgctgctc
tcggcggacggcgatgcgcaggacgaggtcctcgggttcgacgacggcgccgacgtccgg
ctggtcacgctggtgctcgacgcgcccgagctcgacgcggcgccgcgcggcacgggcgtg
ctggtggcgcgtgaggtcgagcaggtggccgccaaggccctcacgcacggcaccgccaag
tggccgtggctcgccgcggcgacgcctccgggcacgcacgtggtccggctgtcctacgga
cggtccgacgacgagccggccgacgactcccccgcgggtcccgacgcgcggcccgagctg
gtggcccgcgcgctcgccgacgcgcgcgtgctgctgggtgtgccgctgcgcgacgagcag
gtcctggcgagcgcggtggtgcgctggacgcagtcgctgccgcggcccagcgcacggcac
cgggacgcgacggccgcgctgcgggctgcggtcgcggcacgcccggacggcacgcgggtc
gcggtgtgcggggcgtgggtcgcgggcaacgggctcgcgtcggtgatccccgacgcggtc
gccgcggcgcgtaccgtgctcgactga

DBGET integrated database retrieval system