KEGG   Cellulomonas gilvus: Celgi_3105Help
Entry
Celgi_3105        CDS       T01537                                 

Definition
Uroporphyrinogen III synthase HEM4
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
cga  Cellulomonas gilvus
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Heme biosynthesis, glutamate => protoheme/siroheme
Brite
KEGG Orthology (KO) [BR:cga00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Celgi_3105
Enzymes [BR:cga01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     Celgi_3105
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3423393..3424238
Genome map
AA seq 281 aa AA seqDB search
MTAALPTPGDGPLAGLRVLVPRPTAGQSAAAIALTAAGATPVVVPLIAIEPPADPGPLDD
ALRALGAGWYRWLVVTSGAAVPVLADRAAAAGRALPDLVAGGGVLVAAVGPGTARALAAA
GLTAALTPRGASTGANLAAQWPAPRADETARVLFARGDLAASTVADGLRARGWLVDEVIA
YRTVAAPAPPDDVRADWQAGRIDAALLTSASTVRALVDSLGMPPAGTALVAIGPTTAAEA
ARLGVPLAATAAEQTMSGLVEALAAHVGQSYTPPLPPSEAS
NT seq 846 nt NT seq  +upstreamnt  +downstreamnt
atgaccgcggccctgcccacgccgggcgacggcccgctggcgggtctgcgcgtcctggtg
ccgcgtcccaccgccggccagtccgccgccgcgatcgcgctgaccgccgcgggtgcgacg
cccgtcgtcgtgccgctgatcgcgatcgagccaccggccgacccgggcccgctcgacgac
gcgctgcgggccctgggcgcgggctggtaccgctggctcgtggtgaccagcggcgccgcc
gtgccggtcctcgccgaccgtgccgccgccgcgggccgcgcgctgcccgacctggtcgcg
ggcggcggcgtgctcgtcgcggccgtcggccccggcaccgcgcgtgcgctggccgccgcg
ggcctgaccgcggccctgacgccgcgcggcgcgtccacgggcgcgaacctggccgcccag
tggcccgcgccgcgcgccgacgagaccgcgcgcgtgctgttcgcgcgcggcgacctcgcg
gcctccacggtggccgacggcctgcgcgcgcgcggctggctggtcgacgaggtgatcgcg
taccgcacggtcgcggcaccggccccgcccgacgacgtgcgcgcggactggcaggccggc
cgcatcgacgccgcgctgctcacgtccgccagcacggtgcgcgcgctggtggactcgctc
ggcatgcccccggccgggaccgcgctggtcgcgatcggcccgaccaccgccgcggaggcc
gcgcgcctcggcgtgcccctggccgcgaccgcggccgagcagaccatgagcggcctggtc
gaggcgctcgccgcgcacgtcggtcagtcgtacaccccgccccttcccccctcggaggca
tcgtga

  All links  
No link information was found.   
DBGET integrated database retrieval system