KEGG   Cellvibrio gilvus: Celgi_3106Help
Entry
Celgi_3106        CDS       T01537                                 

Definition
porphobilinogen synthase
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
cga  Cellvibrio gilvus
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Heme biosynthesis, glutamate => protoheme/siroheme
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:cga00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3424235..3425236
Genome map
AA seq 333 aa AA seqDB search
MTHPLPHPGRVRPRRLRATPAMRRLVREVDVHPRQLVLPVFVREGLDAPRPIASMPGVQQ
HTLDSLRAAVAQAADARLGGVMLFAVPEVRDAVGTQATDPDGILNRAIAAATAEAGDALV
VQADLCLDEFTDHGHCGVLTSDGRVDNDATLVRYADMALAQAAAGAHLVGLSGMMDGQVG
VVRDALDQAGHDDVAVLAYAAKYASAFYGPFRDAVESQLEGDRRTYQMDPANRREAAREV
AIDVTEGADVVMVKPALAYLDVLADVAATSQVPVAAYAVSGEYAMIEAAAAAGWIERERA
IRESVLSIRRAGADHVLTYHATELAGWLAEEYR
NT seq 1002 nt NT seq  +upstreamnt  +downstreamnt
gtgacgcacccgctcccgcaccccggccgggtccgcccccgccggctgcgtgccaccccc
gcgatgcgccgtctggtgcgcgaggtcgacgtccacccgcgccagctggtgctgcccgtg
ttcgtccgcgagggcctcgacgcgccccgcccgatcgcctcgatgcccggcgtgcagcag
cacacgctcgactcgttgcgcgcggccgtcgcccaggcggccgacgcccgtctgggtggc
gtgatgctgttcgcggtccccgaggtccgggacgcggtcggcacgcaggccaccgacccg
gacggcatcctcaaccgcgcgatcgccgccgcgacggccgaggcgggtgacgcgctcgtg
gtgcaggccgacctgtgcctcgacgagttcacggaccacggccactgcggcgtgctgacg
tcggacggccgtgtggacaacgacgcgacgctggtccggtacgcggacatggcgctcgcg
caggccgccgcgggcgcccacctggtgggcctgtccgggatgatggacggccaggtgggc
gtggtgcgcgacgcgctggaccaggccggtcacgacgacgtggccgtgctcgcctacgcc
gccaagtacgcgagcgcgttctacggcccgttccgggacgcggtcgagtcccagctcgag
ggcgaccgccgcacgtaccagatggaccccgccaaccggcgcgaggcggcgcgcgaggtg
gccatcgacgtgaccgagggtgccgacgtggtcatggtcaagcccgcgctcgcgtacctg
gacgtgctcgccgacgtcgcggcgaccagccaggtgccggtcgccgcttatgccgtctcg
ggcgagtacgccatgatcgaggcggccgcggcggccggctggatcgagcgcgaacgggcg
atacgcgagtccgtgctcagcatccggcgcgccggtgccgatcacgtactgacgtaccac
gcgacggagctggccggctggctggcggaggagtaccgatga

DBGET integrated database retrieval system