KEGG   Cellulomonas gilvus: Celgi_3149Help
Entry
Celgi_3149        CDS       T01537                                 

Definition
Endo-1,4-beta-xylanase
Orthology
K01181  
endo-1,4-beta-xylanase [EC:3.2.1.8]
Organism
cga  Cellulomonas gilvus
Brite
Enzymes [BR:cga01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.8  endo-1,4-beta-xylanase
     Celgi_3149
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3466090..3467499)
Genome map
AA seq 469 aa AA seqDB search
MTIPRRGHPGRLAAAAGGLVAAALAVALAVPATAAGSTLQAAAAESGRYFGTAIAASRLN
DGTYSSIANREFNMITAENEMKMDATEPQRGQFNFSSGDQIVSWARQNGKKVRGHALAWH
SQQPGWMQNMSGSALRQAMLDHVTQVATHYRGQVYAWDVVNEAFADGSSGARRDSNLQRT
GNDWIEAAFRAARAADPNAKLCYNDYNTDNWSHAKTQAVYSMVRDFKSRGVPIDCVGFQA
HFNSGNPVPSNYHTTLQNFAALGVDVQITELDIEGSGTSQAQQYQGVVQACLSEARCTGI
TVWGVRDTDSWRASGTPLLFDGSGNKKAAYTSVLNALNAGGTSVTPGPTNPTPGPTNPTT
NPTTPPPTTGGSCTATYSEGQKWGDRFNGTVTIRANGNISSWTSVVTVRSPQKVIATWNG
SPSWDWSGNVMTVRPSGNGALASGQTTSFGFTVQHNGTWTWPSVTCVAS
NT seq 1410 nt NT seq  +upstreamnt  +downstreamnt
atgacgatcccacgcaggggccatcccggccgtctcgccgccgcagccggcgggctggtc
gccgccgcgctcgccgtggcactcgccgtcccggccaccgcggccgggagcacgctgcag
gccgccgccgccgagagcggccggtacttcggcaccgccatcgccgcgagcaggctcaac
gacggcacgtacagcagcatcgcgaaccgcgagttcaacatgatcaccgcggagaacgag
atgaagatggacgccaccgagccgcagcgcggccagttcaacttcagcagcggcgaccag
atcgtcagctgggcccggcagaacggcaagaaggtgcgcggtcacgcgctcgcgtggcac
tcgcagcagcccggctggatgcagaacatgtccggcagcgcgctgcggcaggccatgctc
gaccacgtcacgcaggtggccacgcactaccgcggccaggtctacgcgtgggacgtggtc
aacgaggcgttcgccgacggctcgtcgggcgcccgtcgcgactccaacctgcagcgcacg
ggcaacgactggatcgaggcggcgttccgcgccgcacgcgccgcggacccgaacgccaag
ctctgctacaacgactacaacaccgacaactggtcgcacgccaagacgcaggccgtctac
tcgatggtccgcgacttcaagtcgcgcggcgttccgatcgactgcgtcgggttccaggcg
cacttcaactcgggcaacccggtgccctcgaactaccacacgacgctgcagaacttcgcg
gcgctgggcgtggacgtccagatcaccgagctggacatcgagggctccgggacgtcgcag
gcccagcagtaccagggcgtggtccaggcgtgcctgtccgaggcgcggtgcaccggcatc
acggtctggggcgtgcgcgacacggactcgtggcgcgcgtccggcacgccgctgctgttc
gacgggtccggcaacaagaaggccgcgtacacgagcgtcctcaacgcgctgaacgcgggc
ggcacgtccgtcacgcccggtccgacgaaccccacgccgggtccgacgaaccccaccacc
aaccccacgacgccgccgcccacgacgggcggctcgtgcaccgcgacgtactcggagggc
cagaagtggggtgaccgcttcaacggcacggtgaccatccgcgccaacgggaacatctcg
agctggacgtcggtggtgaccgtcaggtcgccgcagaaggtgatcgccacctggaacggc
tcgccgtcctgggactggtccggcaacgtcatgacggtccgccccagcgggaacggggcg
ctcgcctcgggtcagacgacctcgttcggcttcacggtccagcacaacggcacctggacg
tggcccagcgtcacgtgcgtggcctcgtga

DBGET integrated database retrieval system