KEGG   Corynebacterium glutamicum ATCC 13032 (Bielefeld): cg0273Help
Entry
cg0273            CDS       T00244                                 

Definition
alcohol dehydrogenase (EC:1.1.1.1)
Orthology
K00001  
alcohol dehydrogenase [EC:1.1.1.1]
Organism
cgb  Corynebacterium glutamicum ATCC 13032 (Bielefeld)
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:cgb00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    cg0273
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    cg0273
  Lipid metabolism
   00071 Fatty acid degradation
    cg0273
  Amino acid metabolism
   00350 Tyrosine metabolism
    cg0273
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    cg0273
   00626 Naphthalene degradation
    cg0273
Enzymes [BR:cgb01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     cg0273
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
236327..237346
Genome map
AA seq 339 aa AA seqDB search
MPKYIAMQVSESGAPLAANLVQPAPLKSREVRVEIAASGVCHADIGTAAASGKHTVFPVT
PGHEIAGTIAEIGENVSRWTVGDRVAIGWFGGNCGDCAFCRAGDPVHCRERKIPGVSYAG
GWAQNIVVPAEALAAIPDGMDFYEAAPMGCAGVTTFNALRNLKLDPGAAVAVFGIGGLVR
LAIQFAAKMGYRTITIARGLEREELARQLGANHYIDSNDLHPGQALFELGGADLILSTAS
TTEPLSELSTGLSIGGQLTIIGVDGGDITVSAAQLMMNRQIITGHLTGSANDTEQTMKFA
HLHGVKPLIERMPLDQANEAIARISAGKPRFRIVLEPNS
NT seq 1020 nt NT seq  +upstreamnt  +downstreamnt
atgcccaaatacattgccatgcaggtatccgaatccggtgcaccgttagccgcgaatctc
gtgcaacctgctccgttgaaatcgagggaagtccgcgtggaaatcgctgctagtggtgtg
tgccatgcagatattggcacggcagcagcatcggggaagcacactgtttttcctgttacc
cctggtcatgagattgcaggaaccatcgcggaaattggtgaaaacgtatctcggtggacg
gttggtgatcgcgttgcaatcggttggtttggtggcaattgcggtgactgcgctttttgt
cgtgcaggtgatcctgtgcattgcagagagcggaagattcctggcgtttcttatgcgggt
ggttgggcacagaatattgttgttccagcggaggctcttgctgcgattccagatggcatg
gacttttacgaggccgccccgatgggctgcgcaggtgtgacaacattcaatgcgttgcga
aacctgaagctggatcccggtgcggctgtcgcggtctttggaatcggcggtttagtgcgc
ctagctattcagtttgctgcgaaaatgggttatcgaaccatcaccatcgcccgcggttta
gagcgtgaggagctagctaggcaacttggcgccaaccactacatcgatagcaatgatctg
caccctggccaggcgttatttgaacttggcggggctgacttgatcttgtctactgcgtcc
accacggagcctctttcggagttgtctaccggtctttctattggcgggcagctaaccatt
atcggagttgatgggggagatatcaccgtttcggcagcccaattgatgatgaaccgtcag
atcatcacaggtcacctcactggaagtgcgaatgacacggaacagactatgaaatttgct
catctccatggcgtgaaaccgcttattgaacggatgcctctcgatcaagccaacgaggct
attgcacgtatttcagctggtaaaccacgtttccgtattgtcttggagccgaattcataa

DBGET integrated database retrieval system