KEGG   Corynebacterium glutamicum ATCC 13032 (Bielefeld): cg0298Help
Entry
cg0298            CDS       T00244                                 

Gene name
recR
Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
cgb  Corynebacterium glutamicum ATCC 13032 (Bielefeld)
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:cgb00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    cg0298 (recR)
DNA repair and recombination proteins [BR:cgb03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      cg0298 (recR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
261403..262059
Genome map
AA seq 218 aa AA seqDB search
MFEGPLQDLIDELSRLPGVGPKSAQRIAFHLLNVDPSDITRLQEALGGVRDGVQFCRICC
NISREEVCRICSDSGRDGGTICVVEEPKDIQVIERTGEFSGRYHVLGGALDPLANIGPRE
LNISTLLQRIGGVLPDRELADSTPENKLFDATPTVREVILATDPNTEGEATASYLGRLLK
DFPDLVISRLASGMPLGGDLEFVDELTLSRALSGRLQI
NT seq 657 nt NT seq  +upstreamnt  +downstreamnt
gtgtttgaaggcccactccaggatctcatcgacgaactttctcgtctccccggcgtcggc
cccaaaagtgcccaacgcatcgcatttcacctgctcaacgtagatccttccgacattacc
cgccttcaggaagccctcggaggcgtgcgtgatggcgtccaattctgccgcatctgctgc
aacatttcccgcgaagaagtctgtcgcatctgctccgactccggacgtgacggcggaaca
atctgtgtcgtcgaagaaccaaaagacatccaagttatcgagcgcaccggcgaattctcc
ggccgctaccacgtcctcggcggcgccctcgacccgctggccaacatcggcccccgcgaa
ctcaacatttccacgctcctgcagcgcatcggcggcgtcctgccagaccgtgagctcgca
gattccacgcctgaaaataagcttttcgacgccacccccaccgtccgcgaagtcatcctc
gcaacagaccccaacaccgaaggcgaagccaccgcctcatacctcggccgcctcttgaaa
gacttcccagatctggtaatttcccgcctcgcatccggaatgccactaggcggcgacctc
gaattcgtcgacgaactcactctctcccgagcattgagtggccgcctgcagatctag

DBGET integrated database retrieval system