KEGG   Corynebacterium glutamicum ATCC 13032 (Bielefeld): cg0298Help
Entry
cg0298            CDS       T00244                                 

Gene name
recR
Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
cgb  Corynebacterium glutamicum ATCC 13032 (Bielefeld)
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:cgb03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
261403..262059
Genome map
AA seq 218 aa AA seqDB search
MFEGPLQDLIDELSRLPGVGPKSAQRIAFHLLNVDPSDITRLQEALGGVRDGVQFCRICC
NISREEVCRICSDSGRDGGTICVVEEPKDIQVIERTGEFSGRYHVLGGALDPLANIGPRE
LNISTLLQRIGGVLPDRELADSTPENKLFDATPTVREVILATDPNTEGEATASYLGRLLK
DFPDLVISRLASGMPLGGDLEFVDELTLSRALSGRLQI
NT seq 657 nt NT seq  +upstreamnt  +downstreamnt
gtgtttgaaggcccactccaggatctcatcgacgaactttctcgtctccccggcgtcggc
cccaaaagtgcccaacgcatcgcatttcacctgctcaacgtagatccttccgacattacc
cgccttcaggaagccctcggaggcgtgcgtgatggcgtccaattctgccgcatctgctgc
aacatttcccgcgaagaagtctgtcgcatctgctccgactccggacgtgacggcggaaca
atctgtgtcgtcgaagaaccaaaagacatccaagttatcgagcgcaccggcgaattctcc
ggccgctaccacgtcctcggcggcgccctcgacccgctggccaacatcggcccccgcgaa
ctcaacatttccacgctcctgcagcgcatcggcggcgtcctgccagaccgtgagctcgca
gattccacgcctgaaaataagcttttcgacgccacccccaccgtccgcgaagtcatcctc
gcaacagaccccaacaccgaaggcgaagccaccgcctcatacctcggccgcctcttgaaa
gacttcccagatctggtaatttcccgcctcgcatccggaatgccactaggcggcgacctc
gaattcgtcgacgaactcactctctcccgagcattgagtggccgcctgcagatctag

DBGET integrated database retrieval system