KEGG   Corynebacterium glutamicum ATCC 13032 (Bielefeld): cg0442Help
Entry
cg0442            CDS       T00244                                 

Gene name
galU2
Definition
UTP-glucose-1-phosphate uridylyltransferase (EC:2.7.7.9)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
cgb  Corynebacterium glutamicum ATCC 13032 (Bielefeld)
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:cgb00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    cg0442 (galU2)
   00052 Galactose metabolism
    cg0442 (galU2)
   00500 Starch and sucrose metabolism
    cg0442 (galU2)
   00520 Amino sugar and nucleotide sugar metabolism
    cg0442 (galU2)
Enzymes [BR:cgb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     cg0442 (galU2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
389249..390172
Genome map
AA seq 307 aa AA seqDB search
MSLPIAQHQNAVKTVVVPAAGMGTRFLPATKTIPKELLPVVDTPGIELVAKEAADLGATR
LAIITAPNKDGILKHFEEFPELEATLEARGKTDQLNKVRAARELIATVPVVQEKPLGLGH
AVGLAESVLDDDEDVVAVMLPDDLVLPFGVTERMAEVRAKFGGSVLAAIEVAEDEVSNYG
VFKLGELDAESESEGIRRVVGMVEKPAPEDAPSRFAATGRYLLDRAIFDALRRIEPGAGG
ELQLTDAIALLIEEGHPVHIVVHEGKRHDLGNPAGYIPAVVYFGLRHAEYGSKIHRAVKE
ILAEFES
NT seq 924 nt NT seq  +upstreamnt  +downstreamnt
atgagtttgccaatagctcagcatcaaaatgctgtaaaaactgtcgtggtaccagctgca
ggaatgggaacacggttccttcctgcaacgaagacaattccaaaggagcttcttcctgta
gttgataccccgggtattgaacttgttgccaaagaggctgctgatcttggtgcaactcgg
ttagcaattatcactgctccgaacaaagacggaattcttaaacacttcgaggagttccct
gagcttgaggcaactcttgaggctcgcggtaagactgatcaactgaataaagttcgagca
gctcgagaattgattgcaacagttccagtggttcaagaaaagccattggggcttggtcac
gctgttggccttgctgagtctgtgctcgatgatgatgaagatgttgtggctgtcatgctg
ccagacgatttggtgctgccatttggtgtgaccgagagaatggcagaagttcgcgctaag
tttggcggatctgttcttgcagcaattgaggtggctgaagatgaagtctcaaattacgga
gtatttaagctcggtgaactcgatgcagagtccgaaagtgaaggcattaggcgtgttgta
ggaatggttgaaaagcctgcgcctgaagatgcaccatcaaggtttgccgcaacgggccgt
tatctacttgatcgagctatttttgatgcactgcgtcgaattgagcctggtgctggtgga
gaactgcaattaacagatgccatcgcattattgatcgaagaaggccatccggtacacatt
gtggttcatgaaggaaagcgccatgaccttggtaatccagctgggtacattcctgctgtt
gtgtacttcggacttcgtcatgcagagtacggttccaagattcaccgtgcggtgaaggaa
atactcgctgagtttgaatcttaa

DBGET integrated database retrieval system