KEGG   Corynebacterium glutamicum ATCC 13032 (Bielefeld): cg0510Help
Entry
cg0510            CDS       T00244                                 

Gene name
hemD
Definition
(GenBank) UROPORPHYRINOGEN III SYNTHASE/METHYLTRANSFERASE
  KO
K13542  uroporphyrinogen III methyltransferase / synthase [EC:2.1.1.107 4.2.1.75]
Organism
cgb  Corynebacterium glutamicum ATCC 13032 (Bielefeld)
Pathway
cgb00860  Porphyrin and chlorophyll metabolism
cgb01100  Metabolic pathways
cgb01110  Biosynthesis of secondary metabolites
cgb01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:cgb00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    cg0510 (hemD)
Enzymes [BR:cgb01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.107  uroporphyrinogen-III C-methyltransferase
     cg0510 (hemD)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     cg0510 (hemD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HEM4 TP_methylase
Motif
Other DBs
NCBI-ProteinID: CAF19145
Position
452636..454432
Genome map
AA seq 598 aa AA seqDB search
MTIAHKPEMAETTGIETNQVSETIGVESLTHGNLRPVSSFEGQHEGQTEELLPGKVIFVG
AGPGNPDLLTVRAREVLGNAVRAITDEQVLSGVRAFVATEIPVPEDKLQAAEDEYERICI
EAKENGARRKPPRPAPPTAAEITEVSEATPAQIVELVQDALSYGGDVIRLVTGNPLSSDA
TLAEISAVSEAGLEFQVVPGMSLPATVPAFAGIALGSTYTETDVNGQNLDWDQLASAPQP
LVLQARVDDLSRIAQELKARNMSLETPVSVTANGTTRLQRTYDTTLGLLHKLDAELSGPL
VVTLGKGVDDRSKYSWWENRALYGWRVLVPRAREQAASMSARLSSHGAIPQEVPTISVEP
PRNPAQMERAIKGIVEGRYQWVVLTSVNAVKAVWEKITEFGLDSRSFAGVRIAAVGEKTA
AEIRALGITPELLPARTRQNAQGLVDVFPEYFEELDPVGRVLLPRADIATDVLVDGLTHL
GWEVEDVVAYRTVRAAPPSADIRDMIKTGGFDAVAFTSSSTVKNLVGIAGKPHPRTIVAC
IGPMTAATAEELGLRVDVMPEIAEVPELIDALAEHVADLRAKGELPPPRKKRRRRKAS
NT seq 1797 nt NT seq  +upstreamnt  +downstreamnt
atgactatcgcccataagcccgagatggctgaaactaccgggatcgagaccaaccaggtt
tccgaaaccatcggggttgaatcgctcacgcacggaaacttacgtcctgtttcatctttt
gagggacagcatgagggacaaacggaagagttacttccaggcaaagtcatttttgttggg
gccggtcccggtaaccctgatcttcttacagttcgtgcccgtgaagttctgggcaacgcg
gttcgtgcgattactgatgaacaagtactaagcggcgttcgagcttttgtcgccactgaa
attcctgtgccggaagataagcttcaggctgcggaagatgagtacgagcgcatctgcatt
gaagcgaaggagaacggtgcacgccgtaagcctcctcgtccagcaccaccaaccgctgca
gagatcacggaagtttctgaggcgactccagctcagattgttgagcttgtgcaggatgct
ctttcttatggtggagatgttattcgtcttgtcaccggcaacccattgagcagcgatgcc
acactggctgagatctctgcagtttccgaggctggcctggagttccaggtggttccaggt
atgtctttgcctgcaacggttcctgcatttgcgggaattgcgttgggttctacctacacc
gaaactgatgtcaacggtcaaaacttggactgggatcagttggctagcgcacctcagcct
ttggtgctgcaggcccgcgtggatgacctttcccgtattgcacaggaactaaaggcccgc
aatatgtctttggaaactcctgtttctgtcaccgctaacggcaccacccgtttgcagcgc
acctatgacaccactttaggtctgttgcacaagcttgatgctgaactaagcggacctttg
gttgttaccttgggcaagggtgtggatgatcgctccaagtactcttggtgggaaaaccgc
gctctgtacggttggcgtgtgctggtgcctcgcgctcgggagcaagcggcatccatgtcc
gcacgtctgagcagccacggcgctatcccgcaggaagtccctaccatttctgtcgaacca
ccgcgcaacccagcgcaaatggaacgcgccatcaagggcatcgtcgaaggacgctaccag
tgggttgtcctcaccagcgtcaacgcagtgaaggcagtctgggagaaaatcaccgaattc
ggcctcgattcacgttccttcgcgggcgtccgcatcgccgcagtcggtgaaaaaaccgcc
gctgagatccgcgcgctcggcatcacgccggagcttctgcctgcacgtaccaggcaaaat
gcgcaagggcttgtcgacgtgttccccgaatatttcgaagaactcgatccagtcggccgt
gtcctcttgccgcgcgcagatatcgcaaccgacgtgcttgtcgacggcctgacccacctt
ggttgggaagtcgaagacgtggtggcttaccgcaccgtccgcgcagcaccaccaagcgct
gatatccgagatatgatcaagaccggcggatttgatgcagttgccttcacctcttcgtcg
accgtgaagaacctcgttggtatcgcgggtaaaccacacccacgcaccatcgtcgcgtgc
atcggacccatgactgcagcgaccgctgaagaactgggactgcgcgttgatgtcatgcca
gagatcgccgaagtaccagaactgatcgacgctcttgcggaacacgtggcggatctgcgc
gctaagggcgagctgccgccgccgaggaagaaacgcaggcgtcgaaaagcgtcttaa

DBGET integrated database retrieval system