KEGG   Corynebacterium glutamicum ATCC 13032 (Bielefeld): cg0512Help
Entry
cg0512            CDS       T00244                                 

Gene name
hemB
Definition
delta-aminolevulinic acid dehydratase (EC:4.2.1.24)
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
cgb  Corynebacterium glutamicum ATCC 13032 (Bielefeld)
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:cgb00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
454966..455985
Genome map
AA seq 339 aa AA seqDB search
MSTSSDYSHALIRRPRRLRANPAMRELVAETALRPADLILPMFFADGITEAREISSMPGV
YQHTEDSLLRAAHEALDAGVRCVDLFGVPVDADKDFNGSQAWSETGVLNRALSSLRKEFG
DDLLIMADTCLDEFTDHGHCGVVTEDRHGNAIVDNDATLPLYQQMAVAQARAGAHIVSPS
GMMDGQIAAIRAALDEEGYQDVAIMAYSAKYASAFFGPFREAVGSSLQGDRRTYQQDPAN
LRESLLEAELDIAEGADFIMVKPALPYLDVLTRIADTSPVPVAAYQVSGEYAMIQAAGRN
GWVDLDAVMMESLTSIKRAGANQILTYFAVDAARALRNA
NT seq 1020 nt NT seq  +upstreamnt  +downstreamnt
atgagcacttcttctgattactcccacgcactaattcgtcgtccgcgccgacttcgcgcc
aaccctgcgatgcgggaactagtcgcggaaaccgcattgcgcccggcggatcttattctg
ccaatgttctttgcggatggaatcactgaggcacgtgagatctcctccatgccgggcgtt
tatcagcacactgaagattcgctgctgcgtgccgcccatgaggctttagatgctggtgtt
cgttgcgttgatctgttcggtgttccagtggatgcggacaaggacttcaatggttcccag
gcatggtctgaaaccggtgtgttgaaccgtgcactttcatcgctgcgtaaggaattcggc
gatgacctgctgattatggccgatacttgccttgatgagttcacggatcatggtcactgc
ggcgtagttaccgaggaccgccatggaaacgcaatcgtggacaacgatgccactttgccg
ctgtaccagcagatggctgttgctcaggctcgtgccggtgcacatattgtgagcccttcc
ggaatgatggacggccagatcgctgctattcgtgcagcgttggatgaggaaggctaccag
gacgtcgccatcatggcgtattccgctaagtatgcatcagcattcttcggacctttccgc
gaagcagtgggatcctccctccaaggcgatcgacgtacctaccagcaagatcctgcgaac
ctgcgtgagtctctccttgaggcagagctagatatcgcagaaggagcggacttcattatg
gtcaagcctgcactgccataccttgatgtgctgacccgcatcgctgatacctcacctgtc
ccagtggctgcctaccaagtttctggtgagtacgcgatgatccaagcagcaggccgcaac
ggttgggttgaccttgatgcagtgatgatggaatctttgacctccatcaagcgtgccggt
gcaaaccaaatcctcacgtactttgccgttgacgctgcccgcgcactgcgaaacgcttaa

DBGET integrated database retrieval system