KEGG   Corynebacterium glutamicum ATCC 13032 (Bielefeld): cg0512Help
Entry
cg0512            CDS       T00244                                 

Gene name
hemB
Definition
(GenBank) DELTA-AMINOLEVULINIC ACID DEHYDRATASE
  KO
K01698  porphobilinogen synthase [EC:4.2.1.24]
Organism
cgb  Corynebacterium glutamicum ATCC 13032 (Bielefeld)
Pathway
cgb00860  Porphyrin and chlorophyll metabolism
cgb01100  Metabolic pathways
cgb01110  Biosynthesis of secondary metabolites
cgb01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:cgb00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    cg0512 (hemB)
Enzymes [BR:cgb01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     cg0512 (hemB)
Exosome [BR:cgb04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   cg0512 (hemB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ALAD Mob_Pre
Motif
Other DBs
NCBI-ProteinID: CAF19147
Position
454966..455985
Genome map
AA seq 339 aa AA seqDB search
MSTSSDYSHALIRRPRRLRANPAMRELVAETALRPADLILPMFFADGITEAREISSMPGV
YQHTEDSLLRAAHEALDAGVRCVDLFGVPVDADKDFNGSQAWSETGVLNRALSSLRKEFG
DDLLIMADTCLDEFTDHGHCGVVTEDRHGNAIVDNDATLPLYQQMAVAQARAGAHIVSPS
GMMDGQIAAIRAALDEEGYQDVAIMAYSAKYASAFFGPFREAVGSSLQGDRRTYQQDPAN
LRESLLEAELDIAEGADFIMVKPALPYLDVLTRIADTSPVPVAAYQVSGEYAMIQAAGRN
GWVDLDAVMMESLTSIKRAGANQILTYFAVDAARALRNA
NT seq 1020 nt NT seq  +upstreamnt  +downstreamnt
atgagcacttcttctgattactcccacgcactaattcgtcgtccgcgccgacttcgcgcc
aaccctgcgatgcgggaactagtcgcggaaaccgcattgcgcccggcggatcttattctg
ccaatgttctttgcggatggaatcactgaggcacgtgagatctcctccatgccgggcgtt
tatcagcacactgaagattcgctgctgcgtgccgcccatgaggctttagatgctggtgtt
cgttgcgttgatctgttcggtgttccagtggatgcggacaaggacttcaatggttcccag
gcatggtctgaaaccggtgtgttgaaccgtgcactttcatcgctgcgtaaggaattcggc
gatgacctgctgattatggccgatacttgccttgatgagttcacggatcatggtcactgc
ggcgtagttaccgaggaccgccatggaaacgcaatcgtggacaacgatgccactttgccg
ctgtaccagcagatggctgttgctcaggctcgtgccggtgcacatattgtgagcccttcc
ggaatgatggacggccagatcgctgctattcgtgcagcgttggatgaggaaggctaccag
gacgtcgccatcatggcgtattccgctaagtatgcatcagcattcttcggacctttccgc
gaagcagtgggatcctccctccaaggcgatcgacgtacctaccagcaagatcctgcgaac
ctgcgtgagtctctccttgaggcagagctagatatcgcagaaggagcggacttcattatg
gtcaagcctgcactgccataccttgatgtgctgacccgcatcgctgatacctcacctgtc
ccagtggctgcctaccaagtttctggtgagtacgcgatgatccaagcagcaggccgcaac
ggttgggttgaccttgatgcagtgatgatggaatctttgacctccatcaagcgtgccggt
gcaaaccaaatcctcacgtactttgccgttgacgctgcccgcgcactgcgaaacgcttaa

DBGET integrated database retrieval system