KEGG   Corynebacterium glutamicum ATCC 13032 (Bielefeld): cg1004Help
Entry
cg1004            CDS       T00244                                 

Gene name
galU1
Definition
UTP-glucose-1-phosphate uridylyltransferase (EC:2.7.7.9)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
cgb  Corynebacterium glutamicum ATCC 13032 (Bielefeld)
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:cgb00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    cg1004 (galU1)
   00052 Galactose metabolism
    cg1004 (galU1)
   00500 Starch and sucrose metabolism
    cg1004 (galU1)
   00520 Amino sugar and nucleotide sugar metabolism
    cg1004 (galU1)
Enzymes [BR:cgb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     cg1004 (galU1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Structure
PDB: 

Jmol
Position
935844..936791
Genome map
AA seq 315 aa AA seqDB search
MSLPIDEHVNAVKTVVVPAAGLGTRFLPATKTVPKELLPVVDTPGIELIAAEAAELGATR
LAIITAPNKAGVLAHFERSSELEETLMERGKTDQVEIIRRAADLIKAVPVTQDKPLGLGH
AVGLAESVLDDDEDVVAVMLPDDLVLPTGVMERMAQVRAEFGGSVLCAVEVSEADVSKYG
IFEIEADTKDSDVKKVKGMVEKPAIEDAPSRLAATGRYLLDRKIFDALRRITPGAGGELQ
LTDAIDLLIDEGHPVHIVIHQGKRHDLGNPGGYIPACVDFGLSHPVYGAQLKDAIKQILA
EHEAAERIADDSQVK
NT seq 948 nt NT seq  +upstreamnt  +downstreamnt
atgagtttgcctatcgatgagcacgtgaacgcggttaaaaccgtcgtagtgcctgctgca
ggactgggaacccgattccttccggccaccaaaaccgtacccaaggagttgctgccggtt
gtcgataccccaggtattgagctgattgctgctgaggctgccgaacttggtgcgaccagg
ctggcgatcatcactgcgccaaacaaagctggggtacttgcacactttgagcgttcttct
gaattggaagaaacgctgatggagcgtggcaagactgaccaggtggagataatccgccgc
gccgccgatttaatcaaggcagttccagtaacccaggacaagccgctggggctaggtcat
gctgttggtttggctgagtctgtgttggatgatgatgaagatgtcgtagcggtgatgttg
ccggacgatctcgtgttgccaaccggtgttatggagcgcatggctcaggtccgagcagag
ttcggtggatctgtcctttgtgcagttgaggtttctgaagctgacgtttctaagtatggc
atctttgaaatcgaagctgacaccaaagattccgatgtcaaaaaggtcaagggcatggtg
gaaaaaccagccatcgaagacgcgccatcacgcctcgccgcgactggccgctacctgctt
gaccgaaaaatctttgacgccctgcgccgcatcacaccaggcgctggcggcgagttgcag
ctcaccgacgcgattgatttgcttatcgacgaaggccatccggtccatatcgtcattcac
cagggcaaacgccacgatcttggcaaccctggcgggtacattccggcgtgtgttgatttc
ggtctgtcccaccctgtttatggtgcgcagctaaaagatgcaatcaaacagattttggct
gaacatgaagctgcggaacgtattgcagacgattctcaagtaaaatag

DBGET integrated database retrieval system