KEGG   Corynebacterium glutamicum ATCC 13032 (Bielefeld): cg1039Help
Entry
cg1039            CDS       T00244                                 

Definition
(GenBank) PUTATIVE ISOPENTENYL MONOPHOSPHATE KINASE
  KO
K00919  4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
cgb  Corynebacterium glutamicum ATCC 13032 (Bielefeld)
Pathway
cgb00900  Terpenoid backbone biosynthesis
cgb01100  Metabolic pathways
cgb01110  Biosynthesis of secondary metabolites
cgb01130  Biosynthesis of antibiotics
Module
cgb_M00096  C5 isoprenoid biosynthesis, non-mevalonate pathway
Brite
KEGG Orthology (KO) [BR:cgb00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    cg1039
Enzymes [BR:cgb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     cg1039
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GHMP_kinases_C GHMP_kinases_N
Motif
Other DBs
NCBI-ProteinID: CAF19617
UniProt: Q8NRY0
Position
967322..968257
Genome map
AA seq 311 aa AA seqDB search
MKITAKAWAKTNLHLGVGPAHDDGFHELMTVFQTIDLFDTVTLTTLDEELVEEGSVVKQL
SVTGARGVPEDASNLAWRAVDALVKRRAEKTPLSAVSLHISKGIPVAGGMAGGSADAAAT
LRAVDAWIGPFGEDTLLEVAAELGSDVPFCLLGGTMRGTGRGEQLVDMLTRGKLHWVVAA
MAHGLSTPEVFKKHDELNPESHMDISDLSAALLTGNTAEVGQWLHNDLTSAALSLRPELR
SVLQEGIRSGAHAGIVSGSGPTTVFLCESEHKAQDVKEALIDAGQVYAAYTATGPAASTA
DQRGAHILTVS
NT seq 936 nt NT seq  +upstreamnt  +downstreamnt
gtgaaaattaccgctaaggcgtgggcgaaaaccaacctgcatttaggtgtgggaccggct
cacgacgatggatttcacgagctcatgacggtgtttcaaaccattgatctgtttgacacc
gtcaccttaaccaccctcgatgaggagttggtggaggaggggagcgtcgtcaagcaatta
tctgtgaccggtgcccgtggcgtgcctgaggacgccagcaatcttgcgtggcgcgctgtg
gatgcgttggttaagcggcgcgcggaaaagacgccgctgtctgcagtttcgctgcatatt
tccaaggggattccggtggctggcggcatggctggcggctctgcggatgcggctgcgaca
ctgcgcgcagtggatgcctggattgggcctttcggcgaggacacattgctggaggttgcc
gcggagctcggctcagatgtgccgttttgcctgcttggtggcaccatgcgcggtaccggt
cgcggcgagcagctggtagatatgttgacgcgcggcaagctacattgggtggtggccgcg
atggcgcatggcctgtccacgcctgaggtattcaaaaagcatgatgagctgaatccggaa
tcgcatatggatatcagcgacctcagcgccgcacttctcaccggcaacaccgccgaggtg
gggcagtggctgcacaatgatctgaccagcgccgcactcagtttgcgccctgaactgcgc
agcgtcctccaagaaggcatccgctccggcgcgcatgcaggaattgtctccggctccggc
ccgaccacggtattcttgtgcgaatcggagcacaaagcgcaagacgttaaagaggcgcta
atcgacgccggccaggtgtacgctgcttacaccgccaccggccctgcggcctcaaccgcc
gaccagcgcggcgcacacattttgactgtttcataa

DBGET integrated database retrieval system