KEGG   Corynebacterium glutamicum ATCC 13032 (Bielefeld): cg1203Help
Entry
cg1203            CDS       T00244                                 

Definition
Mg-chelatase subunit ChlI
Orthology
K03405  
magnesium chelatase subunit I [EC:6.6.1.1]
Organism
cgb  Corynebacterium glutamicum ATCC 13032 (Bielefeld)
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cgb00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    cg1203
Enzymes [BR:cgb01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     cg1203
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1107553..1108926)
Genome map
AA seq 457 aa AA seqDB search
MWGVSLPPNVQTVGELKAAGHIYRPLRVEIRDNLLAKLRSGEDPWPGLHGLNYTVIPQLE
RALIAGHDIVLLGERGQGKTRLLRTLITLLDEWSPIIPGRDVPEHPLAPNVEISDDQPIE
WVHRDARYTEKLATPDTSVADLIGDVDPMRVAEGRSLGDLETIHYGLIPRANRGIVAINE
LPDLAERIQVAMLNVMEERDVQIRGYNIRLDLDVLVVASANPEDYTNRGRIITPLKDRFG
AEIRTHYPLELDDEVAIIRQEAELVAQVPDILVEILARYTRALRESSSVNQRSGVSARFS
IAGAETVAAAALRRAAVFGEDEAVARLVDLEAAVEVLGGKIEFESGEEGREWEILDYLLR
TATAEALRSTLRSLDLTPLIAALDGSITVSTGTNITASEFLASLPELGESTLYDDIAQAF
GATTPSTRAMAIELALEGLYLSRKIAKDSGEGETIYG
NT seq 1374 nt NT seq  +upstreamnt  +downstreamnt
gtgtggggtgtgagtcttccaccaaatgtacaaactgtcggtgagctgaaggccgccggc
cacatctaccgacctttgcgcgtagaaatccgcgacaacctcctagccaaacttcgcagc
ggcgaagatccgtggccaggcctgcacggcctgaactacacggtcatcccgcagcttgaa
cgcgcgctcatcgccggccacgacatcgtgctgctcggcgaacgcggccagggtaaaacc
cgcctgctccgcacgttaataacgcttctcgacgagtggtccccgatcattcccgggcgc
gacgttccagaacaccctcttgcgccaaacgtagagatctccgatgatcagcccattgaa
tgggtacaccgcgatgcgcgctataccgagaaacttgccaccccagatacttccgtggct
gatcttatcggtgatgttgacccaatgcgtgttgctgaaggccgcagcctcggtgatcta
gaaaccattcactacggtctgattcctcgcgccaaccgtggcatcgtggcgatcaacgag
cttcctgacctcgctgaacgcatccaggttgccatgctcaacgtcatggaggaacgtgat
gtgcagattcgtggctacaacattcgtttggacttggatgtgctggttgttgcctcagcc
aaccctgaggattacaccaaccgtggccgaattatcactccgctcaaagaccgcttcggt
gcagaaatccgcacccactacccacttgagttggacgatgaagtggcaattatccgccag
gaagcagagcttgttgcgcaagtccctgatatcttggttgaaattcttgcccgctacacc
cgagcgcttcgtgaatcctcatcggtgaatcagcgttctggtgtgtctgctcgtttctcc
attgcaggtgcagaaactgtggccgcagcagctcttcgacgcgcagcagtgttcggcgaa
gatgaggccgttgcccgcctggttgatttggaagcagccgtggaagtcctcggcggcaag
attgaatttgaatccggcgaagaaggacgcgaatgggaaatccttgattatctcctgcgc
accgcaaccgcagaagcgctgcgttccactctgcgctcgctggatctcaccccgctcatc
gcagcattagacggcagcatcaccgtttccactggcacgaacatcaccgcgtcagaattt
ttggcttcgctccccgaactcggcgaaagcacgctatatgacgacatcgctcaagctttt
ggtgccaccacaccaagtactcgcgcgatggccattgagcttgctttggaaggtctttac
ctttcccgaaaaattgccaaggattctggcgaaggtgaaaccatttacggttaa

DBGET integrated database retrieval system