KEGG   Corynebacterium glutamicum ATCC 13032 (Bielefeld): cg1260Help
Entry
cg1260            CDS       T00244                                 

Gene name
dapE
Definition
succinyl-diaminopimelate desuccinylase (EC:3.5.1.18)
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
cgb  Corynebacterium glutamicum ATCC 13032 (Bielefeld)
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:cgb01230]
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:cgb00300]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Structure
PDB: 

Jmol
Position
1157199..1158308
Genome map
AA seq 369 aa AA seqDB search
MNSELKPGLDLLGDPIVLTQRLVDIPSPSGQEKQIADEIEDALRNLNLPGVEVFRFNNNV
LARTNRGLASRVMLAGHIDTVPIADNLPSRVEDGIMYGCGTVDMKSGLAVYLHTFATLAT
STELKHDLTLIAYECEEVADHLNGLGHIRDEHPEWLAADLALLGEPTGGWIEAGCQGNLR
IKVTAHGVRAHSARSWLGDNAMHKLSPIISKVAAYKAAEVNIDGLTYREGLNIVFCESGV
ANNVIPDLAWMNLNFRFAPNRDLNEAIEHVVETLELDGQDGIEWAVEDGAGGALPGLGQQ
VTSGLIDAVGREKIRAKFGWTDVSRFSAMGIPALNFGAGDPSFAHKRDEQCPVEQITDVA
AILKQYLSE
NT seq 1110 nt NT seq  +upstreamnt  +downstreamnt
gtgaactctgaactcaaaccaggattagatctcctcggcgacccaattgtccttactcaa
cgtttggtagatataccgagtccgtcgggtcaggaaaagcagattgctgatgaaattgaa
gatgcccttcggaaccttaatctacctggtgtagaggtcttccgcttcaacaacaacgtt
cttgctcgcacgaacaggggattggcctcgagggtcatgcttgctggtcatatcgataca
gtgccgatcgcggacaatctgccaagccgtgtggaagacggcatcatgtatggctgtggc
accgtcgatatgaaatctgggttggcggtgtatttgcatacttttgccaccttggccacg
tcgactgagcttaaacatgatctgacgctgattgcgtatgagtgcgaggaagttgctgat
cacctcaatggtttgggccacattcgcgatgagcatccggagtggttggcggctgatttg
gcgttgttgggtgagcctactggcggctggattgaggcgggctgccagggcaatctgcgc
atcaaggtgacggcgcatggtgtgcgtgcccattcggcgagaagctggttgggtgataat
gcgatgcataagttgtcgccgatcatttcgaaggttgctgcgtataaggccgcagaagtc
aacattgatggcttgacctaccgtgaaggcctcaacatcgttttctgcgaatcgggcgtg
gcaaacaacgtcattccagacctcgcgtggatgaacctcaacttccgtttcgcgccgaat
cgcgatctcaacgaggcgatcgagcatgtcgtcgaaacgcttgagcttgacggtcaagac
ggcatcgaatgggccgtagaagacggggcaggcggtgcccttccaggcttggggcagcag
gtgacaagcgggcttatcgacgccgtcggccgcgaaaaaatccgcgcaaaattcggctgg
accgatgtctcacgtttttcagccatgggaattccagccctaaactttggcgctggtgat
ccaagtttcgcgcataaacgcgacgagcagtgcccagtggagcaaatcacggatgtggca
gcaattttgaagcagtacctgagcgagtaa

DBGET integrated database retrieval system