KEGG   Corynebacterium glutamicum ATCC 13032 (Bielefeld): cg1260Help
Entry
cg1260            CDS       T00244                                 

Gene name
dapE
Definition
(GenBank) SUCCINYL-DIAMINOPIMELATE DESUCCINYLASE
  KO
K01439  succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
cgb  Corynebacterium glutamicum ATCC 13032 (Bielefeld)
Pathway
cgb00300  Lysine biosynthesis
cgb01100  Metabolic pathways
cgb01120  Microbial metabolism in diverse environments
cgb01230  Biosynthesis of amino acids
Module
cgb_M00016  Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
Brite
KEGG Orthology (KO) [BR:cgb00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    cg1260 (dapE)
Enzymes [BR:cgb01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     cg1260 (dapE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M20 M20_dimer Peptidase_M28
Motif
Other DBs
NCBI-ProteinID: CAF19815
UniProt: Q59284
Structure
PDB: 

Jmol
Position
1157199..1158308
Genome map
AA seq 369 aa AA seqDB search
MNSELKPGLDLLGDPIVLTQRLVDIPSPSGQEKQIADEIEDALRNLNLPGVEVFRFNNNV
LARTNRGLASRVMLAGHIDTVPIADNLPSRVEDGIMYGCGTVDMKSGLAVYLHTFATLAT
STELKHDLTLIAYECEEVADHLNGLGHIRDEHPEWLAADLALLGEPTGGWIEAGCQGNLR
IKVTAHGVRAHSARSWLGDNAMHKLSPIISKVAAYKAAEVNIDGLTYREGLNIVFCESGV
ANNVIPDLAWMNLNFRFAPNRDLNEAIEHVVETLELDGQDGIEWAVEDGAGGALPGLGQQ
VTSGLIDAVGREKIRAKFGWTDVSRFSAMGIPALNFGAGDPSFAHKRDEQCPVEQITDVA
AILKQYLSE
NT seq 1110 nt NT seq  +upstreamnt  +downstreamnt
gtgaactctgaactcaaaccaggattagatctcctcggcgacccaattgtccttactcaa
cgtttggtagatataccgagtccgtcgggtcaggaaaagcagattgctgatgaaattgaa
gatgcccttcggaaccttaatctacctggtgtagaggtcttccgcttcaacaacaacgtt
cttgctcgcacgaacaggggattggcctcgagggtcatgcttgctggtcatatcgataca
gtgccgatcgcggacaatctgccaagccgtgtggaagacggcatcatgtatggctgtggc
accgtcgatatgaaatctgggttggcggtgtatttgcatacttttgccaccttggccacg
tcgactgagcttaaacatgatctgacgctgattgcgtatgagtgcgaggaagttgctgat
cacctcaatggtttgggccacattcgcgatgagcatccggagtggttggcggctgatttg
gcgttgttgggtgagcctactggcggctggattgaggcgggctgccagggcaatctgcgc
atcaaggtgacggcgcatggtgtgcgtgcccattcggcgagaagctggttgggtgataat
gcgatgcataagttgtcgccgatcatttcgaaggttgctgcgtataaggccgcagaagtc
aacattgatggcttgacctaccgtgaaggcctcaacatcgttttctgcgaatcgggcgtg
gcaaacaacgtcattccagacctcgcgtggatgaacctcaacttccgtttcgcgccgaat
cgcgatctcaacgaggcgatcgagcatgtcgtcgaaacgcttgagcttgacggtcaagac
ggcatcgaatgggccgtagaagacggggcaggcggtgcccttccaggcttggggcagcag
gtgacaagcgggcttatcgacgccgtcggccgcgaaaaaatccgcgcaaaattcggctgg
accgatgtctcacgtttttcagccatgggaattccagccctaaactttggcgctggtgat
ccaagtttcgcgcataaacgcgacgagcagtgcccagtggagcaaatcacggatgtggca
gcaattttgaagcagtacctgagcgagtaa

DBGET integrated database retrieval system