KEGG   Corynebacterium glutamicum ATCC 13032 (Bielefeld): cg1409Help
Entry
cg1409            CDS       T00244                                 

Gene name
pfkA
Definition
6-phosphofructokinase (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
cgb  Corynebacterium glutamicum ATCC 13032 (Bielefeld)
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
RNA degradation
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:cgb00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    cg1409 (pfkA)
   01230 Biosynthesis of amino acids
    cg1409 (pfkA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    cg1409 (pfkA)
   00030 Pentose phosphate pathway
    cg1409 (pfkA)
   00051 Fructose and mannose metabolism
    cg1409 (pfkA)
   00052 Galactose metabolism
    cg1409 (pfkA)
  Energy metabolism
   00680 Methane metabolism
    cg1409 (pfkA)
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    cg1409 (pfkA)
Enzymes [BR:cgb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     cg1409 (pfkA)
Protein phosphatases and associated proteins [BR:cgb01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     cg1409 (pfkA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1316523..1317554
Genome map
AA seq 343 aa AA seqDB search
MRIATLTSGGDCPGLNAVIRGIVRTASNEFGSTVVGYQDGWEGLLGDRRVQLYDDEDIDR
ILLRGGTILGTGRLHPDKFKAGIDQIKANLEDAGIDALIPIGGEGTLKGAKWLSDNGIPV
VGVPKTIDNDVNGTDFTFGFDTAVAVATDAVDRLHTTAESHNRVMIVEVMGRHVGWIALH
AGMAGGAHYTVIPEVPFDIAEICKAMERRFQMGEKYGIIVVAEGALPREGTMELREGHID
QFGHKTFTGIGQQIADEIHVRLGHDVRTTVLGHIQRGGTPTAFDRVLATRYGVRAARACH
EGSFDKVVALKGESIEMITFEEAVGTLKEVPFERWVTAQAMFG
NT seq 1032 nt NT seq  +upstreamnt  +downstreamnt
atgcgaattgctactctcacgtcaggcggcgactgccccggactaaacgccgtcatccga
ggaatcgtccgcacagccagcaatgaatttggctccaccgtcgttggttatcaagacggt
tgggaaggactgttaggcgatcgtcgcgtacagctgtatgacgatgaagatattgaccga
atcctccttcgaggcggcaccattttgggcactggtcgcctccatccggacaagtttaag
gccggaattgatcagattaaggccaacttagaagacgccggcatcgatgcccttatccca
atcggtggcgaaggaaccctgaagggtgccaagtggctgtctgataacggtatccctgtt
gtcggtgtcccaaagaccattgacaatgacgtgaatggcactgacttcaccttcggtttc
gatactgctgtggcagtggctaccgacgctgttgaccgcctgcacaccaccgctgaatct
cacaaccgtgtgatgatcgtggaggtcatgggccgccacgtgggttggattgctctgcac
gcaggtatggccggcggtgctcactacaccgttattccagaagtacctttcgatattgca
gagatctgcaaggcgatggaacgtcgcttccagatgggcgagaagtacggcattatcgtc
gttgcggaaggtgcgttgccacgcgaaggcaccatggagcttcgtgaaggccacattgac
cagttcggtcacaagaccttcacgggaattggacagcagatcgctgatgagatccacgtg
cgcctcggccacgatgttcgtacgaccgttcttggccacattcaacgtggtggaacccca
actgctttcgaccgtgttctggccactcgttatggtgttcgtgcagctcgtgcgtgccat
gagggaagctttgacaaggttgttgctttgaagggtgagagcattgagatgatcaccttt
gaagaagcagtcggaaccttgaaggaagttccattcgaacgctgggttactgcccaggca
atgtttggatag

DBGET integrated database retrieval system