KEGG   Corynebacterium glutamicum ATCC 13032 (Bielefeld): cg1870Help
Entry
cg1870            CDS       T00244                                 

Gene name
ruvA
Definition
Holliday junction DNA helicase RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
cgb  Corynebacterium glutamicum ATCC 13032 (Bielefeld)
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:cgb00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    cg1870 (ruvA)
Enzymes [BR:cgb01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     cg1870 (ruvA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1763986..1764606)
Genome map
AA seq 206 aa AA seqDB search
MIASLRGTVINIGLSSAVIECNGVGYEVVTTPNTLSQLVRGEEALVLTTMVVREDAMKLY
GFIDNESREMFSVLQTVSGLGPRLALACESVLSPLEISQAITNADAKTLQRVPGVGKRMA
DRLIVELKGKVAAFAAGVVDEGGEQISLPNANIASEVVVEQVSQALVGLGFSEKQSDDAV
SFVLAADPSLDTSGALRAALAKLSGK
NT seq 621 nt NT seq  +upstreamnt  +downstreamnt
atgattgcctcacttcgtggcactgttatcaacattggtctgagctctgctgtcattgaa
tgcaatggcgtgggctatgaggttgtcaccacaccgaacaccttgtcacagttggtccgc
ggtgaggaagcactggtgttgaccaccatggtggtccgcgaagacgcgatgaaactctat
gggtttattgacaatgaatcacgtgagatgttttccgtgttgcaaacagtatctggattg
ggtccacgcctggccttggcatgtgaatcggtgttgagcccactggagatttctcaggcg
atcaccaatgccgatgccaaaactttgcagcgggttccgggtgtgggaaagcgcatggca
gatcgtctcatcgtggagcttaaaggcaaggtcgcagcttttgctgccggtgtcgtggat
gagggaggggagcaaatttccttgcctaacgcgaacattgcttctgaggtggttgtggag
caggtttctcaagcgctggtggggttgggctttagcgagaagcaatcagatgatgcagtg
agctttgtgctggcggcggatccatccttggacaccagtggcgcgcttcgtgccgcattg
gcaaaactcagcggaaagtag

DBGET integrated database retrieval system