KEGG   Corynebacterium glutamicum ATCC 13032 (Bielefeld): cg2188Help
Entry
cg2188            CDS       T00244                                 

Definition
Mg-chelatase subunit I
Orthology
K03405  
magnesium chelatase subunit I [EC:6.6.1.1]
Organism
cgb  Corynebacterium glutamicum ATCC 13032 (Bielefeld)
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:cgb00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2079202..2080305)
Genome map
AA seq 367 aa AA seqDB search
MASQQIRYPFSAVVGQDELRLALILTAISPRIGGVVIRGEKGTAKTTTVRAFAGLLGDAP
LVNLPLGSTEDRVVGSLNMETVLTTGRAEYQPGLLAQADGGVLYVDEVNLLADHLVDALL
DAAASGRVSIERDGISHSSPANFVLVGTMNPEEGELRPQLLDRFGLAVDVAASTNPEVRV
EIIRRRLDFENAPEQFMAKWAEQDADTSNRILAAKDLLPGVELPDLILSQIAWLCARIEV
DGMRADLVITRTALAHAAWAGRTVVTEEDVEIAARLALPHRRRRNPFDAPEMEERKLQET
LQEARDFFKDNEDKGPAAKITDEETGAEAFTDTDNPTEEDGLQGTAQAKAQTTGKVGTAG
SGDPFRS
NT seq 1104 nt NT seq  +upstreamnt  +downstreamnt
atggcgtcacaacagatccgctatccattctccgcggttgtgggacaagacgagcttcgg
cttgcgttgatcctcactgcgatttccccacgcattggtggcgtggtgattcgaggtgag
aagggtacagcgaaaactaccactgtgcgtgcttttgctggtcttttaggtgatgcccct
ttggtgaacttgcctctcggatccacggaggatcgtgtggtgggttccctcaacatggaa
actgtgttgaccaccggccgtgcggaatatcagccaggtttgctcgcgcaggctgatggc
ggtgtgctgtatgtcgatgaggtcaacctcttggcggatcacctggtggatgctctgctc
gatgcagctgcaagcggtcgcgtcagcattgagcgtgacggtatttcgcattcttcacca
gcaaactttgtgttggtgggcaccatgaatccggaggaaggcgagctgcgcccgcagctg
ctggaccgtttcggtttggctgtggacgttgctgcgtctacgaaccctgaggtgcgcgtg
gagatcattcgccgccggcttgattttgaaaacgctcctgagcagttcatggctaagtgg
gctgagcaagatgcggacacctccaaccgtattttggcggctaaggatttgctgcctggt
gtggagctgccggatctgatcttgtcgcagattgcgtggttgtgtgcacgtattgaagtc
gacggtatgcgcgctgacctggtgatcacgcgtaccgcacttgctcacgccgcgtgggct
ggacgcactgtggttacggaagaagacgtggagatcgcagctcgcctagcgttgccgcac
cgccgtcgccgtaatcctttcgatgctccagaaatggaggagcgcaagcttcaggaaacc
ctgcaggaagctcgggacttcttcaaagacaatgaagataaaggacctgccgccaagatc
accgatgaggaaaccggtgcagaggcctttaccgataccgacaatcccaccgaggaagac
ggtctgcaaggaactgcgcaggcgaaggcgcagactactggaaaggtaggtactgccgga
tccggcgacccctttcgctcctag

DBGET integrated database retrieval system