KEGG   Corynebacterium glutamicum ATCC 13032 (Bielefeld): cg2272Help
Entry
cg2272            CDS       T00244                                 

Gene name
mutM1
Definition
(GenBank) FORMAMIDOPYRIMIDINE-DNA GLYCOSYLASE
  KO
K10563  
formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
cgb  Corynebacterium glutamicum ATCC 13032 (Bielefeld)
Pathway
Base excision repair
Brite
KEGG Orthology (KO) [BR:cgb00001]
 Genetic Information Processing
  Replication and repair
   03410 Base excision repair
    cg2272 (mutM1)
Enzymes [BR:cgb01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.23  DNA-formamidopyrimidine glycosylase
     cg2272 (mutM1)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.99  Other carbon-oxygen lyases
    4.2.99.18  DNA-(apurinic or apyrimidinic site) lyase
     cg2272 (mutM1)
DNA repair and recombination proteins [BR:cgb03400]
 Prokaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    DNA glycosylases
     cg2272 (mutM1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(2158342..2159175)
Genome map
AA seq 277 aa AA seqDB search
MRRGLEDHMVGHTIVSATVLHPRAARNQLGGGPEIEANIAGLRVSAAKRRGKFLWLELID
APSGETRPDLGLLVHLGMSGQMLIKEPDAPISPHLRAKVELDNGDEVWFVDQRTFGYWWL
GDLVDGVPERVSHIATDVLDESADFSAIARNLKSRKSEIKRLLLNQEIVSGIGNIYADEM
LWQAKIHPLQRADRLSLARLEELLQAGKDVMTKALAQGGTSFDALYVNVNGNSGYFALSL
NAYAQTGEPCGRCGTLIIRESFMNRGSHYCPNCQKRR
NT seq 834 nt NT seq  +upstreamnt  +downstreamnt
gtgcgccgcggtttagaagatcatatggtcggccacaccatcgtgtccgccacagtgctt
cacccgcgcgcagcccgcaatcaactcggcggtggccccgaaatcgaggccaacatcgca
gggcttagggtcagcgctgccaagcgacgcggcaaattcctctggcttgagcttatcgac
gcaccctccggcgaaacccgtcccgatttagggctactggttcaccttgggatgagtgga
caaatgctcatcaaagaaccagatgcaccaattagtccacaccttcgagccaaagtcgag
ctagataatggcgatgaagtgtggtttgtcgatcaacgcaccttcggttattggtggctc
ggcgacctagttgatggagtacccgaacgcgtctctcacattgccacagatgtattggat
gagtctgctgatttctctgcgattgcgcggaatttgaaatctcggaaatcggagatcaaa
cgcctcctgcttaaccaagagatcgtctccggcatcggaaatatctatgccgatgaaatg
ctctggcaagcaaaaattcacccattgcaacgtgccgatcgactgtccctagctcgcttg
gaagaacttcttcaagctggcaaagacgtgatgaccaaagcacttgctcaaggtggcacc
tctttcgacgcgctctatgtcaacgtcaatggcaactccggctactttgcgctgtcattg
aatgcttatgcgcaaaccggggagccgtgcggacgctgcggaacattaatcatccgggag
agtttcatgaaccgcggctcccactactgcccaaactgccagaagcggcgctag

DBGET integrated database retrieval system