KEGG   Corynebacterium glutamicum ATCC 13032 (Bielefeld): cg2293Help
Entry
cg2293            CDS       T00244                                 

Definition
(GenBank) putative indole-3-glycerol phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
cgb  Corynebacterium glutamicum ATCC 13032 (Bielefeld)
Pathway
cgb00400  Phenylalanine, tyrosine and tryptophan biosynthesis
cgb01100  Metabolic pathways
cgb01110  Biosynthesis of secondary metabolites
cgb01130  Biosynthesis of antibiotics
cgb01230  Biosynthesis of amino acids
Module
cgb_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:cgb00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    cg2293
Enzymes [BR:cgb01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     cg2293
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS NanE
Motif
Other DBs
NCBI-ProteinID: CAF20427
Position
complement(2178395..2179180)
Genome map
AA seq 261 aa AA seqDB search
MVATENRMLMEIAAEISAREATLGFQEVKTKSRSAGLTAAFDIASVFFSSGCNVVVAFDR
FASNWSDHSDHVDYAAQVAGFGASMLAYTVRRGQFDTAVRDIRDIKSEVDIPILLHDPII
DPYQIHEARVMGIDALQFPVWAMEQARLESLVDRTESLGMTAIVSVRNHEEAHRAVDAGA
TVVAIDITGYTGSLTLPEAFSGITQFMPKEVARIVLGGCSSPKELMRFARHSADAIFVPH
ADLATTKSLVTAGMHPACPSR
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atggttgcaacagagaaccgcatgttgatggaaatcgctgcggaaatatcggctcgggaa
gcaacgcttggttttcaagaagtcaaaactaaatctcgatcagcaggtctcacggcggct
ttcgatattgcttcagtctttttttcgtctggatgtaatgtcgtagtcgcctttgatcgt
tttgcatccaattggtctgatcattcggatcatgtggactacgctgcacaggttgcgggt
tttggcgcatcaatgcttgcatatacggtgcgcaggggacagtttgataccgcagtacgc
gatatcagggacatcaaatctgaagtagacattcccattctgcttcatgatcccatcatc
gatccgtatcaaatccacgaagcccgcgtcatgggcatcgacgctcttcaattccccgta
tgggcgatggaacaagctcgactggaatctttggtggaccgcaccgaatcattgggcatg
acagccatcgtgtctgtgcgaaaccacgaagaagcgcatcgtgcagtggacgcaggagcg
acagtggtagcaattgatattactggttataccggctcactcactttgcctgaagcgttt
tcgggtatcacccaattcatgcccaaagaggtagcccgcattgtgctcggaggttgcagc
agccctaaagaactcatgcggtttgcacgacattctgcagacgccatctttgttccacat
gcagacctcgccaccacaaaatctcttgtgacagcaggtatgcatccagcgtgcccatcg
cgttga

DBGET integrated database retrieval system