KEGG   Corynebacterium glutamicum ATCC 13032 (Bielefeld): cg2374Help
Entry
cg2374            CDS       T00244                                 

Gene name
murE
Definition
UDP-N-acetylmuramoylalanyl-D-glutamate--2,6-diaminopimelate ligase (EC:6.3.2.13)
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
cgb  Corynebacterium glutamicum ATCC 13032 (Bielefeld)
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Class
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:cgb00300]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:cgb00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2261192..2262757)
Genome map
AA seq 521 aa AA seqDB search
MATTLLDLTKLIDGILKGSAQGVPAHAVGEQAIAAIGLDSSSLPTSDAIFAAVPGTRTHG
AQFAGTDNAAKAVAILTDAAGLEVLNEAGETRPVIVVDDVRAVLGAASSSIYGDPSKDFT
LIGVTGTSGKTTTSYLLEKGLMEAGHKVGLIGTTGTRIDGEEVPTKLTTPEAPTLQALFA
RMRDHGVTHVVMEVSSHALSLGRVAGSHFDVAAFTNLSQDHLDFHPTMDDYFDAKALFFR
ADSPLVADKQVVCVDDSWGQRMASVAADVQTVSTLGQEADFSATDINVSDSGAQSFKINA
PSNQSYQVELALPGAFNVANATLAFAAAARVGVDGEAFARGMSKVAVPGRMERIDEGQDF
LAVVDYAHKPAAVAAVLDTLRTQIDGRLGVVIGAGGDRDSTKRGPMGQLSAQRADLVIVT
DDNPRSEVPATIRAAVTAGAQQGASESERPVEVLEIGDRAEAIRVLVEWAQPGDGIVVAG
KGHEVGQLVAGVTHHFDDREEVRAALTEKLNNKLPLTTEEG
NT seq 1566 nt NT seq  +upstreamnt  +downstreamnt
atggcaaccacgttgctggacctcaccaaacttatcgatggcatcctcaagggctctgcc
cagggcgttcccgctcacgcagtaggggaacaagcaatcgcggctattggtcttgactcc
tccagcttacctacctcggacgctatttttgctgcagttccaggaacccgcactcacggc
gcacagtttgcaggtacggataacgctgcgaaagctgtggccattttgactgacgcagct
ggacttgaggtgctcaacgaagcaggagagacccgcccagtcatcgttgttgatgatgtc
cgcgcagtacttggcgcagcatcatcaagcatttatggcgatccttcaaaagatttcacg
ctcattggagtcactggaacctcaggtaaaaccaccaccagctacctcttggaaaaagga
ctcatggaggcaggccacaaagttggtttgatcggcaccacaggtacacgtattgacggg
gaagaagtacccacaaagctcaccactccagaagcgccgactctgcaggcattgtttgct
cgaatgcgcgatcacggtgtcacccacgtggtgatggaagtatccagccatgcattgtca
ttgggcagagttgcgggttcccactttgatgtagctgcgtttaccaacctgtcgcaggat
caccttgatttccaccccaccatggatgattactttgacgcgaaggcattgttcttccgc
gcagattctccacttgtggctgacaaacaggtcgtgtgcgtggatgattcttggggtcag
cgcatggccagcgtggcagcggatgtgcaaacagtatccacccttgggcaagaagcagac
ttcagcgctacagacatcaatgtcagcgactctggcgcccagagttttaagatcaacgcc
ccctcaaaccagtcctaccaggtcgagctagctcttccaggtgcgttcaacgttgctaac
gccacgttggcatttgccgctgcggcacgcgtgggtgttgatggcgaagcgtttgctcga
ggcatgtccaaggtcgcggttccaggccgtatggaacgcattgatgagggacaagacttc
cttgcagtggtggattatgcccacaagcctgctgcagtggctgctgtgttggatacgttg
aggacccagattgacgggcgcctcggagtggttatcggtgctggtggagaccgcgattcc
accaagcgtggccccatggggcagttgtccgcacagcgtgctgatctagttattgtcact
gatgacaaccctcgttcagaggtgcctgccacgattcgcgcagcagtcactgcaggagca
cagcagggtgcttcagagtccgaacgaccggtggaagtcctagaaattggtgaccgtgca
gaagcaattcgcgttttggtcgagtgggcacagcctggagatggcattgtagtagctgga
aaaggccatgaagttggacaactagttgctggtgtcacccaccattttgatgaccgcgaa
gaagttcgcgctgctttgacagaaaagctcaacaataaacttccccttactacggaagaa
ggatag

DBGET integrated database retrieval system