KEGG   Corynebacterium glutamicum ATCC 13032 (Bielefeld): cg2399Help
Entry
cg2399            CDS       T00244                                 

Gene name
glk
Definition
glucokinase, transcriptional regulator (EC:2.7.1.2)
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
cgb  Corynebacterium glutamicum ATCC 13032 (Bielefeld)
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:cgb00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    cg2399 (glk)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    cg2399 (glk)
   00052 Galactose metabolism
    cg2399 (glk)
   00500 Starch and sucrose metabolism
    cg2399 (glk)
   00520 Amino sugar and nucleotide sugar metabolism
    cg2399 (glk)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    cg2399 (glk)
   00524 Butirosin and neomycin biosynthesis
    cg2399 (glk)
Enzymes [BR:cgb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     cg2399 (glk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2288251..2289222)
Genome map
AA seq 323 aa AA seqDB search
MPQKPASFAVGFDIGGTNMRAGLVDESGRIVTSLSAPSPRTTQAMEQGIFDLVEQLKAEY
PVGAVGLAVAGFLDPECEVVRFAPHLPWRDEPVREKLENLLGLPVRLEHDANSAAWGEHR
FGAAQGADNWVLLALGTGIGAALIEKGEIYRGAYGTAPEFGHLRVVRGGRACACGKEGCL
ERYCSGTALVYTARELASHGSFRNSGLFDKIKADPNSINGKTITAAARQEDPLALAVLED
FSEWLGETLAIIADVLDPGMIIIGGGLSNAADLYLDRSVNHYSTRIVGAGYRPLARVATA
QLGADAGMIGVADLARRSVVEAN
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
atgccacaaaaaccggccagtttcgcggtgggctttgacatcggcggcaccaacatgcga
gccgggcttgtcgacgaatccgggcgcatcgtgaccagtttgtcggcgccgtcgccgcgc
acgacgcaggcaatggaacaggggatttttgatctagtcgaacagctcaaggccgaatac
ccggttggtgctgtgggacttgccgtcgcgggatttttggatcctgagtgcgaggttgtt
cgatttgccccgcaccttccttggcgcgatgagccagtgcgtgaaaagttggaaaacctt
ttgggcctgcctgttcgtttggaacatgatgccaactcagcagcgtggggtgagcatcgt
tttggtgcagctcaaggcgctgacaactgggttttgttggcactcggcactggaattggt
gcagcgctgattgaaaaaggcgaaatttaccgtggtgcatatggcacggcaccagaattt
ggtcatttgcgtgttgttcgtggcggacgcgcatgtgcgtgtggcaaagaaggctgcctg
gagcgttactgttccggtactgccttggtttacactgcgcgtgaattggcttcgcatggc
tcattccgcaacagcgggctgtttgacaagatcaaagccgatccgaattccatcaatgga
aaaacgatcactgcggcagcgcgccaagaagacccacttgctctcgccgttctggaagat
ttcagcgagtggctgggcgaaactttggcgatcattgctgatgtccttgacccaggcatg
atcatcattggtggcggactgtccaatgctgccgacctttatttggatcgctcggtcaac
cactattccacccgcatcgtcggcgcaggatatcgccctttggcacgcgttgccacagct
cagttgggtgcggatgctggcatgatcggtgtcgctgatctagctcgacgctctgtagtg
gaagccaactag

DBGET integrated database retrieval system