KEGG   Corynebacterium glutamicum ATCC 13032 (Bielefeld): cg2421Help
Entry
cg2421            CDS       T00244                                 

Gene name
aceF
Definition
dihydrolipoamide acetyltransferase (EC:2.3.1.12)
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
cgb  Corynebacterium glutamicum ATCC 13032 (Bielefeld)
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:cgb00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    cg2421 (aceF)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    cg2421 (aceF)
  Amino acid metabolism
   00310 Lysine degradation
    cg2421 (aceF)
Enzymes [BR:cgb01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     cg2421 (aceF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2310941..2312968
Genome map
AA seq 675 aa AA seqDB search
MAFSVEMPELGESVTEGTITQWLKSVGDTVEVDEPLLEVSTDKVDTEIPSPVAGVILEIK
AEEDDTVDVGGVIAIIGDADETPANEAPADEAPAPAEEEEPVKEEPKKEAAPEAPAATGA
ATDVEMPELGESVTEGTITQWLKAVGDTVEVDEPLLEVSTDKVDTEIPSPVAGTIVEILA
DEDDTVDVGAVIARIGDANAAAAPAEEEAAPAEEEEPVKEEPKKEAAPEAPAATGAATDV
EMPELGESVTEGTITQWLKAVGDTVEVDEPLLEVSTDKVDTEIPSPVAGTIVEILADEDD
TVDVGAVIARIGDANAAAAPAEEEAAPAEEEEPVKEEPKKEEPKKEEPKKEAATTPAAAS
ATVSASGDNVPYVTPLVRKLAEKHGVDLNTVTGTGIGGRIRKQDVLAAANGEAAPAEAAA
PVSAWSTKSVDPEKAKLRGTTQKVNRIREITAMKTVEALQISAQLTQLHEVDMTRVAELR
KKNKPAFIEKHGVNLTYLPFFVKAVVEALVSHPNVNASFNAKTKEMTYHSSVNLSIAVDT
PAGLLTPVIHDAQDLSIPEIAKAIVDLADRSRNNKLKPNDLSGGTFTITNIGSEGALSDT
PILVPPQAGILGTGAIVKRPVVITEDGIDSIAIRQMVFLPLTYDHQVVDGADAGRFLTTI
KDRLETANFEGDLQL
NT seq 2028 nt NT seq  +upstreamnt  +downstreamnt
atggcgttctccgtagagatgcccgagctgggcgaatcagtaaccgaaggcacgatcacc
cagtggttgaagtctgttggtgacactgttgaggtagatgagccgttgctcgaggtctca
actgacaaggtcgacaccgagattccctctcctgtcgccggtgtcatcctagagattaag
gctgaagaggatgacaccgtcgacgtcggcggtgtcattgcaataatcggcgatgctgat
gagactcctgccaacgaagctcctgccgacgaggcaccagctcctgccgaagaggaagaa
ccagttaaggaagagccaaagaaggaggcagctcctgaagctccagcagcaactggcgcc
gcaaccgatgtggaaatgccagaactcggcgaatccgtcaccgaaggcaccattacccag
tggctcaaggctgtcggcgacaccgtcgaagtagacgaaccacttcttgaggtctccacc
gacaaggtcgacaccgaaatcccatccccagtagcaggcaccatcgtggagatccttgca
gacgaagacgacaccgtcgacgtcggcgcagtcatcgcccgcatcggtgacgcaaacgca
gctgcagcacctgccgaagaggaagcagctcctgccgaagaggaagaaccagttaaggaa
gagccaaagaaggaggcagctcctgaagctccagcagcaactggcgccgcaaccgatgtg
gaaatgccagaactcggcgaatccgtcaccgaaggcaccattacccagtggctcaaggct
gtcggcgacaccgtcgaagtagacgaaccacttcttgaggtctccaccgacaaggtcgac
accgaaatcccatccccagtagcaggcaccatcgtggagatccttgcagacgaagacgac
accgtcgacgtcggcgcagtcatcgcccgcatcggtgacgcaaacgcagctgcagcacct
gccgaagaggaagcagctcctgccgaagaggaggaaccagttaaggaagagccaaagaag
gaagagcccaagaaggaagagcccaagaaggaagcagctactacacctgctgcggcatcc
gcaactgtgtccgcttctggcgacaacgttccatacgtcaccccactggtgcgcaagctt
gctgaaaagcacggcgttgacttgaacaccgtgaccggtaccggtatcggtggccgtatc
cgcaagcaggatgttttggctgctgcgaacggcgaggctgcacctgctgaggctgctgct
cctgtttccgcttggtccactaagtctgttgaccctgagaaggctaagctccgtggtacc
actcagaaggtcaaccgcatccgtgagatcaccgcgatgaagaccgtcgaggctctgcag
atttctgctcagctcacccagctgcacgaggtcgatatgactcgcgttgctgagctgcgt
aagaagaacaagcccgcgttcatcgagaagcacggtgtgaacctcacttacctgccattc
ttcgtgaaggcagttgtcgaggctttggtttcccatccaaacgtcaacgcgtctttcaac
gcgaagaccaaggagatgacctaccactcctccgttaacctctccatcgctgttgatacc
ccagctggtctgttgaccccagtcattcacgatgctcaggatctctccatcccagagatc
gcaaaggcaattgttgacctggctgatcgttcacgcaacaacaagctgaagccaaacgat
ctgtccggtggcaccttcaccatcaccaacattggttctgaaggcgcactgtctgatacc
ccaatcctggttccaccacaggctggcatcttgggcaccggcgcgatcgtgaagcgtcca
gttgtcatcaccgaggatggaattgattccatcgcgatccgtcagatggtcttcctacca
ctgacctacgaccaccaggttgtagatggcgcagatgctggtcgcttcctgaccaccatc
aaggaccgccttgagaccgctaacttcgaaggcgatctgcagctctaa

DBGET integrated database retrieval system