KEGG   Corynebacterium glutamicum ATCC 13032 (Bielefeld): cg2523Help
Entry
cg2523            CDS       T00244                                 

Gene name
malQ
Definition
4-alpha-glucanotransferase (EC:2.4.1.25)
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
cgb  Corynebacterium glutamicum ATCC 13032 (Bielefeld)
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:cgb00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2401971..2404091
Genome map
AA seq 706 aa AA seqDB search
MTARRFLNELADLYGVATSYTDYKGAHIEVSDDTLVKILRALGVNLDTSNLPNDDAIQRQ
IALFHDREFTRPLPPSVVAVEGDELVFPVHVHDGSPADVHIELEDGTQRDVSQVENWTAP
REIDGIRWGEASFKIPGDLPLGWHKLHLKSNERSAECGLIITPARLSTADKYLDSPRSGV
MAQIYSVRSTLSWGMGDFNDLGNLASVVAQDGADFLLINPMHAAEPLPPTEDSPYLPTTR
RFINPIYIRVEDIPEFNQLEIDLRDDIAEMAAEFRERNLTSDIIERNDVYAAKLQVLRAI
FEMPRSSEREANFVSFVQREGQGLIDFATWCADRETAQSESVHGTEPDRDELTMFYMWLQ
WLCDEQLAAAQKRAVDAGMSIGIMADLAVGVHPGGADAQNLSHVLAPDASVGAPPDGYNQ
QGQDWSQPPWHPVRLAEEGYIPWRNLLRTVLRHSGGIRVDHVLGLFRLFVMPRMQSPATG
TYIRFDHNALVGILALEAELAGAVVIGEDLGTFEPWVQDALAQRGIMGTSILWFEHSPSQ
PGPRRQEEYRPLALTTVTTHDLPPTAGYLEGEHIALRERLGVLNTDPAAELAEDLQWQAE
ILDVAASANALPAREYVGLERDQRGELAELLEGLHTFVAKTPSALTCVCLVDMVGEKRAQ
NQPGTTRDMYPNWCIPLCDSEGNSVLIESLRENELYHRVAKASKRD
NT seq 2121 nt NT seq  +upstreamnt  +downstreamnt
gtgactgctcgcagatttttgaatgaactcgccgatctctacggcgtagcaacttcctac
actgattacaaaggtgcccatattgaggtcagcgatgacacattagtgaaaatcctgcgt
gctctgggtgtgaatttagatacaagcaacctccccaacgatgacgctatccaacgccaa
attgccctcttccatgatcgagagttcactcgcccactgcctccatcggtggttgcagtt
gaaggtgatgaactagttttcccggtgcatgtgcacgacggttcccctgcagatgtccac
atcgaattggaagacggcacgcagcgggatgtttctcaggtggaaaactggacagcgcca
cgggaaattgatgggattaggtggggcgaggcatcgtttaagattcctggtgatctcccc
ttgggttggcacaagcttcaccttaaatccaatgaacgctcagctgagtgcggtttgatc
atcaccccggctcgtctgtctactgctgataagtatcttgattcccctcgcagtggtgtc
atggcgcagatctactctgtgcgttccacgttgtcgtggggcatgggtgatttcaatgat
ttaggaaacttggcaagtgtggttgcccaggatggagcagacttcctgctcatcaacccc
atgcacgctgcagagccgctgcctcctactgaggactctccttatctgcccacaaccagg
cgctttatcaacccgatctacattcgggtagaagatattccggagtttaatcagcttgag
attgatctacgcgatgatatcgcagagatggctgcggaattccgcgaacgcaatctgacc
tcagacatcattgagcgcaatgacgtctacgctgcaaagcttcaagtgctgcgcgccatt
tttgaaatgcctcgttccagcgaacgtgaagccaactttgtctccttcgtgcaacgggaa
ggccaaggtcttattgatttcgccacctggtgcgcggaccgcgaaactgcacagtctgaa
tctgtccacggaactgagccagaccgcgatgagctgaccatgttctacatgtggttgcag
tggctatgtgatgagcagctggcggcagctcaaaagcgcgctgtcgatgccggaatgtcg
atcggcatcatggcagacctggcagttggtgtgcatccaggtggtgctgatgcccagaac
ctcagccacgtacttgctccggatgcgtcagtgggcgccccaccagatggatacaaccag
cagggccaagactggtcccagccaccatggcatccagtgcgtcttgcagaggaaggctac
attccgtggcgtaatctgctgcgcactgtgctgcgtcactccggcggaatccgcgtggac
cacgttcttggtttgttcaggctctttgtcatgccacgcatgcaatcccctgctacgggc
acctatatccgcttcgaccataatgcgttggtaggcattctagccctagaagcagaactc
gcaggcgccgttgtcattggtgaagatctgggaacgtttgagccttgggtacaagatgca
ttggctcagcgtggcatcatgggcacctcgatcctatggttcgagcattccccaagccag
ccgggtcctcgccgccaggaagagtatcgtccgctggccttgaccactgtgaccactcat
gatctccctccgactgctggttatttggagggcgagcacattgctcttcgtgagcgattg
ggggtgctcaacactgatcctgctgcagaactcgctgaggatctgcagtggcaagcggag
atccttgatgtcgcagcatctgccaacgcattgccagcccgggaatacgtgggactcgaa
cgcgatcagcgcggtgagttggctgagctgttggaaggcctgcacactttcgttgcgaaa
accccttcagcactgacctgtgtctgcttggtagacatggtcggtgaaaagcgggcacag
aatcagccgggcacaacgagggatatgtatcccaactggtgtatcccactgtgtgacagc
gaaggcaactccgtgctcattgaatcgctgcgtgaaaatgagctgtatcaccgtgtggca
aaggcaagcaagcgagattag

DBGET integrated database retrieval system