KEGG   Corynebacterium glutamicum ATCC 13032 (Bielefeld): cg2554Help
Entry
cg2554            CDS       T00244                                 

Gene name
rbsK2
Definition
ribokinase (EC:2.7.1.15)
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
cgb  Corynebacterium glutamicum ATCC 13032 (Bielefeld)
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:cgb00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    cg2554 (rbsK2)
Enzymes [BR:cgb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     cg2554 (rbsK2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
2434917..2435822
Genome map
AA seq 301 aa AA seqDB search
MNNRIVVVGSINADLNVLVDRHPAPGETLLGSGGHITAGGKGANQAVAAALQGADVAFVG
AVGKDPYAAPALEFLRSSGVDLTAVSEVDDTTGLAVITVAKDGENNIVVIPGANSLVNCD
YVSSQSALLAEAGILLLQGEIPADGFKEAIHHTMGRVVVNLAPVIEVEKSALLEADPIIA
NEHEAGLILDQFGAGIDSMDPHELAQALLDAGFASVVLTLGSAGALVADATGITDIATPT
VQAVDTTGAGDAFAGAFCARLIKGDSLIDAATHAARVGAYSVQTAGAQASYPDASVSLPS
V
NT seq 906 nt NT seq  +upstreamnt  +downstreamnt
atgaataatcgaattgtcgtagtcggctccatcaacgctgatcttaatgttctcgttgac
cgccacccagcacctggcgaaacactgttgggcagtggtggacacatcactgcaggaggc
aaaggcgccaaccaggcagtagctgccgctcttcaaggtgcagacgtcgcctttgtcggc
gctgtgggcaaggatccttacgctgccccagccttagaattccttcgttcgtcaggcgtc
gaccttacggcagtatccgaagtagatgacaccaccgggcttgcagttatcaccgttgcc
aaagacggcgagaacaatatcgttgtcatccccggcgcgaattccctggtcaattgtgat
tatgtaagcagccaatccgctcttttagctgaagctggaatcctgttgctgcaaggtgag
atccctgcggatggcttcaaagaggccattcaccacaccatgggtcgcgtcgtggtgaat
ctagcgcccgtcatcgaggtagagaagtccgcgttacttgaggctgatccgatcatcgcc
aatgagcacgaggccggcctgattctggatcaattcggggcaggcatcgattccatggat
ccccacgagctcgcgcaagctctcctcgacgccggtttcgcctctgttgttttaacgctt
ggatccgcaggcgcgttggtcgccgatgccaccggtatcacggacatcgccacaccaacg
gtgcaggcagttgacaccacgggagccggtgacgcttttgccggagccttctgcgcacga
ctaattaaaggcgattcgcttatcgacgccgccacccacgcagcacgcgtcggcgcttac
tcggtgcaaaccgccggagcgcaagcgtcctatccggacgcgagcgtttcacttccctct
gtttaa

DBGET integrated database retrieval system