KEGG   Corynebacterium glutamicum ATCC 13032 (Bielefeld): cg2558Help
Entry
cg2558            CDS       T00244                                 

Definition
(GenBank) related to aldose 1-epimerase
  KO
K01792  glucose-6-phosphate 1-epimerase [EC:5.1.3.15]
Organism
cgb  Corynebacterium glutamicum ATCC 13032 (Bielefeld)
Pathway
cgb00010  Glycolysis / Gluconeogenesis
cgb01100  Metabolic pathways
cgb01110  Biosynthesis of secondary metabolites
cgb01120  Microbial metabolism in diverse environments
cgb01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:cgb00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    cg2558
Enzymes [BR:cgb01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.15  glucose-6-phosphate 1-epimerase
     cg2558
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldose_epim
Motif
Other DBs
NCBI-ProteinID: CAF20672
Position
2438834..2439601
Genome map
AA seq 255 aa AA seqDB search
MTTFITSGGLEISPAGAHIVHAESPEGELLFVSSASQYGEGNAIRGGVPIIAPWFGGLLG
LDPAHGWAKRSAWDVTEHDGQIHAEYGRDGLLLDIRANSTKNGFEITLRAYNDTDEARTV
QLAFHPYFKVDDVEKIEVRGLDGVDILNRLNNEVETQDGPVTFDGEFDRIALGTPVVRIF
DTDRIITIEGDGHDSTVVWNPGESRASTVADIGEGEWRDFVCVEPALLGADQKGVRVAPG
QSVTVGMQVSVEKRA
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atgactacttttattacctccggtggcttggaaatctcccccgctggcgctcatattgtt
cacgccgaatcacctgaaggtgagctgttgtttgttagctccgcttcccaatatggggag
ggaaatgcaattaggggtggtgtgcccatcattgctccatggtttggtggactgcttggt
ttggaccctgcacatggttgggcgaagcgttccgcgtgggacgtgactgaacatgacggc
caaattcacgctgaatatggccgcgatggtttactgctggatattcgtgcgaacagcact
aagaatggttttgagatcaccctgcgcgcttacaacgacaccgatgaggcacgcactgtg
cagttggccttccacccttatttcaaggtggatgatgtagaaaagatcgaggtccgtggc
cttgatggggtggacattctcaatcgcctgaacaatgaggtggagacccaagatggtccc
gttacttttgatggcgagttcgatcgcattgcgctagggactccggttgtgaggattttt
gataccgatcgcatcatcaccattgagggcgatggtcatgattccactgtggtgtggaat
ccaggcgaaagtcgcgcctccaccgtggccgatattggcgaaggtgaatggcgcgacttt
gtgtgtgttgaaccggcgcttttgggtgctgaccaaaaaggagtgagggtggctccgggg
cagtcagtcaccgttgggatgcaggtaagcgtcgaaaagcgtgcttag

DBGET integrated database retrieval system