KEGG   Corynebacterium glutamicum ATCC 13032 (Bielefeld): cg2560Help
Entry
cg2560            CDS       T00244                                 

Gene name
aceA
Definition
isocitrate lyase (EC:4.1.3.1)
Orthology
K01637  
isocitrate lyase [EC:4.1.3.1]
Organism
cgb  Corynebacterium glutamicum ATCC 13032 (Bielefeld)
Pathway
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Class
Metabolism; Overview; Carbon metabolism [PATH:cgb01200]
Metabolism; Carbohydrate metabolism; Glyoxylate and dicarboxylate metabolism [PATH:cgb00630]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2442417..2443715
Genome map
AA seq 432 aa AA seqDB search
MSNVGKPRTAQEIQQDWDTNPRWNGITRDYTADQVADLQGSVIEEHTLARRGSEILWDAV
TQEGDGYINALGALTGNQAVQQVRAGLKAVYLSGWQVAGDANLSGHTYPDQSLYPANSVP
SVVRRINNALLRSDEIARTEGDTSVDNWVVPIVADGEAGFGGALNVYELQKAMIAAGAAG
THWEDQLASEKKCGHLGGKVLIPTQQHIRTLNSARLAADVANTPTVVIARTDAEAATLIT
SDVDERDQPFITGERTAEGYYHVKNGLEPCIARAKSYAPYADMIWMETGTPDLELAKKFA
EGVRSEFPDQLLSYNCSPSFNWSAHLEADEIAKFQKELGAMGFKFQFITLAGFHSLNYGM
FDLAYGYAREGMTSFVDLQNREFKAAEERGFTAVKHQREVGAGYFDQIATTVDPNSSTTA
LKGSTEEGQFHN
NT seq 1299 nt NT seq  +upstreamnt  +downstreamnt
atgtcaaacgttggaaagccacgtaccgcacaggaaatccagcaggattgggacaccaac
cctcgttggaacggcatcacccgcgactacaccgcagaccaggtagctgatctgcagggt
tccgtcatcgaggagcacactcttgctcgccgcggctcagagatcctctgggacgcagtc
acccaggaaggtgacggatacatcaacgcgcttggcgcactcaccggtaaccaggctgtt
cagcaggttcgtgcaggcctgaaggctgtctacctgtccggttggcaggtcgcaggtgac
gccaacctctccggccacacctaccctgaccagtccctctacccagcgaactccgttcca
agcgtcgttcgtcgcatcaacaacgcactgctgcgttccgatgaaatcgcacgcaccgaa
ggcgacacctccgttgacaactgggttgtcccaatcgtcgcggacggcgaagctggcttc
ggtggagcactcaacgtctacgaactccagaaggcaatgatcgcagctggcgctgcaggc
acccactgggaagaccagctcgcttctgaaaagaagtgtggccacctcggcggcaaggtt
ctgatcccaacccagcagcacatccgcaccctgaactctgcccgccttgcagcagacgtt
gcaaacaccccaactgttgttatcgcacgtaccgacgctgaggcagcaaccctgatcacc
tctgacgttgatgagcgcgaccaaccattcatcaccggtgagcgcaccgcagaaggctac
taccacgtcaagaatggtctcgagccatgtatcgcacgtgcaaagtcctacgcaccatac
gcagatatgatctggatggagaccggcacccctgacctggagctcgctaagaagttcgct
gaaggcgttcgctctgagttcccagaccagctgctgtcctacaactgctccccatccttc
aactggtctgcacacctcgaggcagatgagatcgctaagttccagaaggaactcggcgca
atgggcttcaagttccagttcatcaccctcgcaggcttccactccctcaactacggcatg
ttcgacctggcttacggatacgctcgcgaaggcatgacctccttcgttgacctgcagaac
cgtgagttcaaggcagctgaagagcgtggcttcaccgctgttaagcaccagcgtgaggtt
ggcgcaggctacttcgaccagatcgcaaccaccgttgacccgaactcttctaccaccgct
ttgaagggttccactgaagaaggccagttccacaactag

DBGET integrated database retrieval system