KEGG   Corynebacterium glutamicum ATCC 13032 (Bielefeld): cg2560Help
Entry
cg2560            CDS       T00244                                 

Gene name
aceA
Definition
(GenBank) ISOCITRATE LYASE
  KO
K01637  isocitrate lyase [EC:4.1.3.1]
Organism
cgb  Corynebacterium glutamicum ATCC 13032 (Bielefeld)
Pathway
cgb00630  Glyoxylate and dicarboxylate metabolism
cgb01100  Metabolic pathways
cgb01110  Biosynthesis of secondary metabolites
cgb01120  Microbial metabolism in diverse environments
cgb01200  Carbon metabolism
Module
cgb_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:cgb00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    cg2560 (aceA)
Enzymes [BR:cgb01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     cg2560 (aceA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ICL PEP_mutase
Motif
Other DBs
NCBI-ProteinID: CAF20674
UniProt: P42449
Position
2442417..2443715
Genome map
AA seq 432 aa AA seqDB search
MSNVGKPRTAQEIQQDWDTNPRWNGITRDYTADQVADLQGSVIEEHTLARRGSEILWDAV
TQEGDGYINALGALTGNQAVQQVRAGLKAVYLSGWQVAGDANLSGHTYPDQSLYPANSVP
SVVRRINNALLRSDEIARTEGDTSVDNWVVPIVADGEAGFGGALNVYELQKAMIAAGAAG
THWEDQLASEKKCGHLGGKVLIPTQQHIRTLNSARLAADVANTPTVVIARTDAEAATLIT
SDVDERDQPFITGERTAEGYYHVKNGLEPCIARAKSYAPYADMIWMETGTPDLELAKKFA
EGVRSEFPDQLLSYNCSPSFNWSAHLEADEIAKFQKELGAMGFKFQFITLAGFHSLNYGM
FDLAYGYAREGMTSFVDLQNREFKAAEERGFTAVKHQREVGAGYFDQIATTVDPNSSTTA
LKGSTEEGQFHN
NT seq 1299 nt NT seq  +upstreamnt  +downstreamnt
atgtcaaacgttggaaagccacgtaccgcacaggaaatccagcaggattgggacaccaac
cctcgttggaacggcatcacccgcgactacaccgcagaccaggtagctgatctgcagggt
tccgtcatcgaggagcacactcttgctcgccgcggctcagagatcctctgggacgcagtc
acccaggaaggtgacggatacatcaacgcgcttggcgcactcaccggtaaccaggctgtt
cagcaggttcgtgcaggcctgaaggctgtctacctgtccggttggcaggtcgcaggtgac
gccaacctctccggccacacctaccctgaccagtccctctacccagcgaactccgttcca
agcgtcgttcgtcgcatcaacaacgcactgctgcgttccgatgaaatcgcacgcaccgaa
ggcgacacctccgttgacaactgggttgtcccaatcgtcgcggacggcgaagctggcttc
ggtggagcactcaacgtctacgaactccagaaggcaatgatcgcagctggcgctgcaggc
acccactgggaagaccagctcgcttctgaaaagaagtgtggccacctcggcggcaaggtt
ctgatcccaacccagcagcacatccgcaccctgaactctgcccgccttgcagcagacgtt
gcaaacaccccaactgttgttatcgcacgtaccgacgctgaggcagcaaccctgatcacc
tctgacgttgatgagcgcgaccaaccattcatcaccggtgagcgcaccgcagaaggctac
taccacgtcaagaatggtctcgagccatgtatcgcacgtgcaaagtcctacgcaccatac
gcagatatgatctggatggagaccggcacccctgacctggagctcgctaagaagttcgct
gaaggcgttcgctctgagttcccagaccagctgctgtcctacaactgctccccatccttc
aactggtctgcacacctcgaggcagatgagatcgctaagttccagaaggaactcggcgca
atgggcttcaagttccagttcatcaccctcgcaggcttccactccctcaactacggcatg
ttcgacctggcttacggatacgctcgcgaaggcatgacctccttcgttgacctgcagaac
cgtgagttcaaggcagctgaagagcgtggcttcaccgctgttaagcaccagcgtgaggtt
ggcgcaggctacttcgaccagatcgcaaccaccgttgacccgaactcttctaccaccgct
ttgaagggttccactgaagaaggccagttccacaactag

DBGET integrated database retrieval system