KEGG   Corynebacterium glutamicum ATCC 13032 (Bielefeld): cg2560Help
Entry
cg2560            CDS       T00244                                 

Gene name
aceA
Definition
isocitrate lyase (EC:4.1.3.1)
Orthology
K01637  
isocitrate lyase [EC:4.1.3.1]
Organism
cgb  Corynebacterium glutamicum ATCC 13032 (Bielefeld)
Pathway
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:cgb00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    cg2560 (aceA)
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    cg2560 (aceA)
Enzymes [BR:cgb01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     cg2560 (aceA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2442417..2443715
Genome map
AA seq 432 aa AA seqDB search
MSNVGKPRTAQEIQQDWDTNPRWNGITRDYTADQVADLQGSVIEEHTLARRGSEILWDAV
TQEGDGYINALGALTGNQAVQQVRAGLKAVYLSGWQVAGDANLSGHTYPDQSLYPANSVP
SVVRRINNALLRSDEIARTEGDTSVDNWVVPIVADGEAGFGGALNVYELQKAMIAAGAAG
THWEDQLASEKKCGHLGGKVLIPTQQHIRTLNSARLAADVANTPTVVIARTDAEAATLIT
SDVDERDQPFITGERTAEGYYHVKNGLEPCIARAKSYAPYADMIWMETGTPDLELAKKFA
EGVRSEFPDQLLSYNCSPSFNWSAHLEADEIAKFQKELGAMGFKFQFITLAGFHSLNYGM
FDLAYGYAREGMTSFVDLQNREFKAAEERGFTAVKHQREVGAGYFDQIATTVDPNSSTTA
LKGSTEEGQFHN
NT seq 1299 nt NT seq  +upstreamnt  +downstreamnt
atgtcaaacgttggaaagccacgtaccgcacaggaaatccagcaggattgggacaccaac
cctcgttggaacggcatcacccgcgactacaccgcagaccaggtagctgatctgcagggt
tccgtcatcgaggagcacactcttgctcgccgcggctcagagatcctctgggacgcagtc
acccaggaaggtgacggatacatcaacgcgcttggcgcactcaccggtaaccaggctgtt
cagcaggttcgtgcaggcctgaaggctgtctacctgtccggttggcaggtcgcaggtgac
gccaacctctccggccacacctaccctgaccagtccctctacccagcgaactccgttcca
agcgtcgttcgtcgcatcaacaacgcactgctgcgttccgatgaaatcgcacgcaccgaa
ggcgacacctccgttgacaactgggttgtcccaatcgtcgcggacggcgaagctggcttc
ggtggagcactcaacgtctacgaactccagaaggcaatgatcgcagctggcgctgcaggc
acccactgggaagaccagctcgcttctgaaaagaagtgtggccacctcggcggcaaggtt
ctgatcccaacccagcagcacatccgcaccctgaactctgcccgccttgcagcagacgtt
gcaaacaccccaactgttgttatcgcacgtaccgacgctgaggcagcaaccctgatcacc
tctgacgttgatgagcgcgaccaaccattcatcaccggtgagcgcaccgcagaaggctac
taccacgtcaagaatggtctcgagccatgtatcgcacgtgcaaagtcctacgcaccatac
gcagatatgatctggatggagaccggcacccctgacctggagctcgctaagaagttcgct
gaaggcgttcgctctgagttcccagaccagctgctgtcctacaactgctccccatccttc
aactggtctgcacacctcgaggcagatgagatcgctaagttccagaaggaactcggcgca
atgggcttcaagttccagttcatcaccctcgcaggcttccactccctcaactacggcatg
ttcgacctggcttacggatacgctcgcgaaggcatgacctccttcgttgacctgcagaac
cgtgagttcaaggcagctgaagagcgtggcttcaccgctgttaagcaccagcgtgaggtt
ggcgcaggctacttcgaccagatcgcaaccaccgttgacccgaactcttctaccaccgct
ttgaagggttccactgaagaaggccagttccacaactag

DBGET integrated database retrieval system