KEGG   Corynebacterium glutamicum ATCC 13032 (Bielefeld): cg2588Help
Entry
cg2588            CDS       T00244                                 

Gene name
proB
Definition
(GenBank) GLUTAMATE 5-KINASE PROTEIN
  KO
K00931  glutamate 5-kinase [EC:2.7.2.11]
Organism
cgb  Corynebacterium glutamicum ATCC 13032 (Bielefeld)
Pathway
cgb00330  Arginine and proline metabolism
cgb00332  Carbapenem biosynthesis
cgb01100  Metabolic pathways
cgb01130  Biosynthesis of antibiotics
cgb01230  Biosynthesis of amino acids
Module
cgb_M00015  Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:cgb00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    cg2588 (proB)
  Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    cg2588 (proB)
Enzymes [BR:cgb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     cg2588 (proB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AA_kinase PUA
Motif
Other DBs
NCBI-ProteinID: CAF21021
UniProt: P0C1E2
Position
complement(2468344..2469573)
Genome map
AA seq 409 aa AA seqDB search
MAPVTGLPVTPYSQEASIGASFPAVDPDTKDSAAYGHESGMRERISNAKRVVVKIGSSSL
TNDEDGHTVDPNRINTIVNALQARMEAGSDLIVVSSGAVAAGMAPLGLSTRPTELAVKQA
AAAVGQVHLMHQWGRSFARYGRPIGQVLLTAADAGKRDRARNAQRTIDKLRILGAVPIVN
ENDTVATTGVNFGDNDRLAAIVAHLVSADALVLLSDVDGLFDKNPTDPTAKFISEVRDGN
DLKGVIAGDGGKVGTGGMASKVSAARLASRSGVPVLLTSAANIGPALEDAQVGTVFHPKD
NRLSAWKFWALYAADTAGKIRLDDGAVEAVTSGGKSLLAVGITEIIGDFQQGEIVEILGP
AGQIIGRGEVSYDSDTLQSMVGMQTQDLPDGMQRPVVHADYLSNYASRA
NT seq 1230 nt NT seq  +upstreamnt  +downstreamnt
atggcgccggtgacagggcttcctgtcaccccctacagccaggaagcaagcatcggtgcg
agcttcccggcagtggatccggacaccaaagacagcgccgcatacggacatgaatccgga
atgcgtgagcgcatctccaacgctaagcgagtggtggtgaaaattggttcgtcctcattg
actaacgatgaggacggacacaccgtcgatcccaaccgcatcaacactattgtcaatgcc
ttgcaagcacgcatggaagctggctcggacctcatcgttgtgtcctctggcgcagtggcc
gcgggaatggccccgcttggattgagcacccggcccacggaattggcagtcaagcaggct
gcagcagcagtggggcaagttcacctcatgcaccagtggggacgttcttttgcccggtat
ggtcgccccatcggccaggtgcttcttaccgcagctgatgcaggaaagcgtgatcgtgcg
aggaatgcgcagcgtaccatcgacaagctgcgcattttgggcgcggttcctatcgtcaat
gaaaatgacaccgtggcaaccaccggtgtgaattttggtgacaacgaccgacttgctgca
attgtggcgcacctggtgtcggctgatgctttggtgctgctcagtgacgtggatggactt
tttgataaaaaccctactgatcccaccgcgaagtttatttccgaggttcgtgacggcaat
gatttgaaaggtgtcattgccggcgacggcggaaaagtgggcaccggtggcatggcatca
aaggtgtctgctgcacgtttggcttcccgaagtggcgtgcctgtgctgttgacctctgcg
gcaaacattggcccagcactggaagacgcccaggtgggcactgtattccaccccaaggac
aaccgcctctccgcgtggaagttctgggctttgtatgccgcagatactgcaggaaagatc
cgactcgatgacggcgcggtggaagcagtgacctccggtggtaaatctttgctggctgtg
ggcattactgaaatcattggtgatttccagcagggtgagatcgtggagatcttgggacct
gccggccaaatcatcgggcgaggcgaggtgtcctacgattctgataccttgcaatcaatg
gttggtatgcaaacgcaggaccttccagatggcatgcagcgcccggtagtgcatgcagat
tatctgtccaactacgccagccgcgcgtaa

DBGET integrated database retrieval system