KEGG   Corynebacterium glutamicum ATCC 13032 (Bielefeld): cg2588Help
Entry
cg2588            CDS       T00244                                 

Gene name
proB
Definition
gamma-glutamyl kinase (EC:2.7.2.11)
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
cgb  Corynebacterium glutamicum ATCC 13032 (Bielefeld)
Pathway
Arginine and proline metabolism
Carbapenem biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:cgb00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    cg2588 (proB)
  Amino acid metabolism
   00330 Arginine and proline metabolism
    cg2588 (proB)
  Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    cg2588 (proB)
Enzymes [BR:cgb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     cg2588 (proB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2468344..2469573)
Genome map
AA seq 409 aa AA seqDB search
MAPVTGLPVTPYSQEASIGASFPAVDPDTKDSAAYGHESGMRERISNAKRVVVKIGSSSL
TNDEDGHTVDPNRINTIVNALQARMEAGSDLIVVSSGAVAAGMAPLGLSTRPTELAVKQA
AAAVGQVHLMHQWGRSFARYGRPIGQVLLTAADAGKRDRARNAQRTIDKLRILGAVPIVN
ENDTVATTGVNFGDNDRLAAIVAHLVSADALVLLSDVDGLFDKNPTDPTAKFISEVRDGN
DLKGVIAGDGGKVGTGGMASKVSAARLASRSGVPVLLTSAANIGPALEDAQVGTVFHPKD
NRLSAWKFWALYAADTAGKIRLDDGAVEAVTSGGKSLLAVGITEIIGDFQQGEIVEILGP
AGQIIGRGEVSYDSDTLQSMVGMQTQDLPDGMQRPVVHADYLSNYASRA
NT seq 1230 nt NT seq  +upstreamnt  +downstreamnt
atggcgccggtgacagggcttcctgtcaccccctacagccaggaagcaagcatcggtgcg
agcttcccggcagtggatccggacaccaaagacagcgccgcatacggacatgaatccgga
atgcgtgagcgcatctccaacgctaagcgagtggtggtgaaaattggttcgtcctcattg
actaacgatgaggacggacacaccgtcgatcccaaccgcatcaacactattgtcaatgcc
ttgcaagcacgcatggaagctggctcggacctcatcgttgtgtcctctggcgcagtggcc
gcgggaatggccccgcttggattgagcacccggcccacggaattggcagtcaagcaggct
gcagcagcagtggggcaagttcacctcatgcaccagtggggacgttcttttgcccggtat
ggtcgccccatcggccaggtgcttcttaccgcagctgatgcaggaaagcgtgatcgtgcg
aggaatgcgcagcgtaccatcgacaagctgcgcattttgggcgcggttcctatcgtcaat
gaaaatgacaccgtggcaaccaccggtgtgaattttggtgacaacgaccgacttgctgca
attgtggcgcacctggtgtcggctgatgctttggtgctgctcagtgacgtggatggactt
tttgataaaaaccctactgatcccaccgcgaagtttatttccgaggttcgtgacggcaat
gatttgaaaggtgtcattgccggcgacggcggaaaagtgggcaccggtggcatggcatca
aaggtgtctgctgcacgtttggcttcccgaagtggcgtgcctgtgctgttgacctctgcg
gcaaacattggcccagcactggaagacgcccaggtgggcactgtattccaccccaaggac
aaccgcctctccgcgtggaagttctgggctttgtatgccgcagatactgcaggaaagatc
cgactcgatgacggcgcggtggaagcagtgacctccggtggtaaatctttgctggctgtg
ggcattactgaaatcattggtgatttccagcagggtgagatcgtggagatcttgggacct
gccggccaaatcatcgggcgaggcgaggtgtcctacgattctgataccttgcaatcaatg
gttggtatgcaaacgcaggaccttccagatggcatgcagcgcccggtagtgcatgcagat
tatctgtccaactacgccagccgcgcgtaa

DBGET integrated database retrieval system