KEGG   Corynebacterium glutamicum ATCC 13032 (Bielefeld): cg2728Help
Entry
cg2728            CDS       T00244                                 

Gene name
glsK
Definition
(RefSeq) glutaminase (EC:3.5.1.2)
  KO
K01425  
glutaminase [EC:3.5.1.2]
Organism
cgb  Corynebacterium glutamicum ATCC 13032 (Bielefeld)
Pathway
Arginine biosynthesis
Alanine, aspartate and glutamate metabolism
D-Glutamine and D-glutamate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cgb00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    cg2728 (glsK)
   00220 Arginine biosynthesis
    cg2728 (glsK)
  Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    cg2728 (glsK)
Enzymes [BR:cgb01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.2  glutaminase
     cg2728 (glsK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2598164..2599405)
Genome map
AA seq 413 aa AA seqDB search
MLTMPIPEYLHEILDDVRDTTSGELADYIPELKSADPNPLAVALCTVNGHIYSAGDDDIE
FTMQSISKPFAYALALQECGFDEVSASVALEPSGEAFNELSLDGENRPMNPMINAGAIAI
NQLINGSDSTVEDRVEKIRHYFSELAGRELTIDRVLAESELAGADRNLSIAHMLRNYGVI
EDEAHDAVLSYTLQCAIKVTTRDLAVMTATLAAGGTHPITGKKLLDARVCRLTLSVMASA
GMYDEAGQWLSTVGIPAKSGVAGGLIGILPGQLGIATFSPRLNPKGNSVRGVKIFKQLSD
DMGLHLMSTEQVSGHAVRSITRDGDTTFIQMQGAMNFSASESFLHAIVEHNFEGTEVVLD
LTRVLSFHPVAIRMIKEGLKRIRDAGFEVFILDPDDVLPDFMFSDGTICKERV
NT seq 1242 nt NT seq  +upstreamnt  +downstreamnt
atgttgacgatgccgatacccgagtacctgcacgaaattttagatgatgtccgcgacacc
acctccggcgagttggccgattacatcccggaactaaaatctgcggacccaaacccgctg
gcagtagccctgtgcaccgttaacggacacatctacagcgcaggcgatgacgacatcgaa
ttcaccatgcaaagtatttccaagccatttgcctacgcactcgcactccaagaatgcggc
tttgatgaggtctctgcatccgtggccttggagccctccggtgaggccttcaacgaactt
tccctcgacggcgaaaaccgccccatgaaccccatgatcaacgccggcgcgatcgccatc
aaccagctgatcaacggctccgattccaccgtggaagaccgcgtggaaaaaatccgacac
tacttctctgaacttgctggacgcgaactcaccatcgaccgcgtgcttgccgaatccgaa
ctcgccggcgccgaccgcaacctctccatcgcccacatgctgcgcaattacggcgtcatc
gaagacgaagcccacgacgccgtcctcagctacacgctgcaatgcgccatcaaagtaacc
acgcgcgacctcgcagtcatgaccgccacgctcgccgccggcggcacacacccaattacc
ggcaagaagcttctcgacgcccgcgtctgccgcctcaccctctccgtcatggcttcagca
ggcatgtacgacgaggcagggcagtggctctccaccgtaggcatccccgcgaaatcagga
gtcgccggcggactcatcggcattctgccaggtcagctgggcatcgccacattttcccca
cgcctgaaccccaaaggcaacagcgtgcgcggcgtaaaaatattcaaacagctttccgac
gacatgggcctccacctcatgtccaccgagcaggtatccggccacgcagtacgatccatc
acgcgggacggcgacaccaccttcatccaaatgcagggcgccatgaacttctccgccagc
gaaagcttcctccacgccatcgtggaacacaactttgaaggcaccgaagttgttcttgat
ctcacccgagtacttagcttccaccccgtagccatccgcatgatcaaagaaggcctcaaa
cgcatccgcgacgcaggctttgaggtgttcatcctcgacccagatgacgtactgcccgat
ttcatgttttccgacggcaccatctgcaaagaacgagtgtga

DBGET integrated database retrieval system